SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000018265 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000018265
Domain Number 1 Region: 10-211
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.13e-45
Family DBL homology domain (DH-domain) 0.00077
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000018265
Domain Number - Region: 225-255
Classification Level Classification E-value
Superfamily PH domain-like 0.000738
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000018265   Gene: ENSORLG00000014569   Transcript: ENSORLT00000018266
Sequence length 255
Comment pep:known_by_projection chromosome:MEDAKA1:17:22422579:22428550:-1 gene:ENSORLG00000014569 transcript:ENSORLT00000018266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PFLMLQVELDQEKGLEMRKWVLSGILASEETYLSHLEALLIPMKPLRAVATTSQPMLTIP
EIETIFFKVPELHEIHKDFYDALLPRVQDWSNQQCVGDLFQKLASQLGVYRAFVDNYKVA
VETADKCCQANAQFAQISENLKVKSTKDCKEQPAKNSLETLLYKPVDRVTRSTLVLHDLL
KHTPSSHPDYPLLQDALRISQNFLSSINEEITPRRQSMTIKKGENRQLLRDRFMVELVEG
SRKLRHIFLFTDLLL
Download sequence
Identical sequences H2MHZ4
8090.ENSORLP00000018265 ENSORLP00000018265 ENSORLP00000018265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]