SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000018348 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000018348
Domain Number 1 Region: 45-109
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.04e-20
Family HkH motif-containing C2H2 finger 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000018348   Gene: ENSORLG00000014641   Transcript: ENSORLT00000018349
Sequence length 127
Comment pep:known_by_projection chromosome:MEDAKA1:22:9547078:9548027:1 gene:ENSORLG00000014641 transcript:ENSORLT00000018349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTMGKSKQTGNHKNKNIKTLKTKRRTKDLDQIHTDMKPETAAKLLNQEVDYDVTGCAQHY
CLHCARYFVDMRSLKEHFKTKVHKKRLKQLREEPYTQAEADRAAGMGSYIPPKMIEVKTQ
PVEEDMD
Download sequence
Identical sequences H2MI74
8090.ENSORLP00000018348 ENSORLP00000018348 ENSORLP00000018348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]