SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000018352 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000018352
Domain Number 1 Region: 87-315,363-413
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.26e-48
Family LacY-like proton/sugar symporter 0.045
Further Details:      
 
Domain Number 2 Region: 527-672
Classification Level Classification E-value
Superfamily MFS general substrate transporter 4.32e-16
Family Glycerol-3-phosphate transporter 0.039
Further Details:      
 
Domain Number 3 Region: 434-514
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.000000000235
Family Pentapeptide repeats 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000018352   Gene: ENSORLG00000014644   Transcript: ENSORLT00000018353
Sequence length 675
Comment pep:known_by_projection chromosome:MEDAKA1:6:22425407:22447982:-1 gene:ENSORLG00000014644 transcript:ENSORLT00000018353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GYQADYSPQDEDAASDATEGHDEEDQMYEGEYQGIPHPDEMKAAQRAAREAPVSGSNGTL
YPGRKKAKDRSAGSAVSELEELAEQYEDIMEDCGHGRFQWTLFLVLGLALMADGVECFVV
AFVLPSAEKDLCLSNAEKGMLGLVVFLSMMVGAFLWGGLADKVGRRRCLKVALGINCIFA
FLSSFAQDYGFFLFFRLLSGIGIGGTVPIVYSYFSEFLQMDKRGEHLSWLCMFWMIGGIY
ASFTAWGIIPSYGWGLSMGTEFQFHSWRIFVLVAVLPAVASLIGLLFMPESPRFLLENAK
HDEAWMILKRIHDTNWRAKGQPEKVFTVTHIKAPKTAEDEFIEIQSSTGTPVQRWAVRSL
TLCKLVLRNMASLLSAELRLATLFMAVIWFCIAFSYYGLSVWFPDMIKHLQYEEYEAKVK
MFHRERVENFHFNFSLENQIHIQGEYIRDKFISIEMKSVKFEDSLFEDCRFEDIRSTDTV
FENCTIRSTVFYNTDLWEEKFIDCRMENATFEHNKHGCHLDTMRENDVLIYLVSFLGSLA
VLPGNIISALFVEKVGRVKIIGGSMLISAGCSFLLFLSFSQAAIIVLQCLFCGVSAAAWN
GIQVVTVELYPASKRATAFGLLNALCKLAAVLGSSIFASFVGVSKAIPILLSFSALVCGG
LVALKLPDTRQKILH
Download sequence
Identical sequences H2MI78
ENSORLP00000018352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]