SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000018365 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000018365
Domain Number 1 Region: 86-316,365-412
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.88e-47
Family LacY-like proton/sugar symporter 0.025
Further Details:      
 
Domain Number 2 Region: 531-672
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.62e-17
Family Glycerol-3-phosphate transporter 0.034
Further Details:      
 
Domain Number 3 Region: 436-514
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0000000000353
Family Pentapeptide repeats 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000018365   Gene: ENSORLG00000014648   Transcript: ENSORLT00000018366
Sequence length 677
Comment pep:known_by_projection chromosome:MEDAKA1:3:31648739:31665300:1 gene:ENSORLG00000014648 transcript:ENSORLT00000018366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEYTYTQDGGGQDGYPYQTDYPQQDDDAASDATEGADEDDQMYEGEYQGIPHPDEIKMAR
RAARLEAKRKARLAEQQEEEESLPEQYESIMEDCGHGRFQWMLFFVLGLALMADGVDGFV
VGFVLPSAEKDMCISNADKGLLGLLVYVAMMVGALVWGGLCDKMGRRKCLIYVLTIDLVF
SFLSCFAQGYGFFLFLRICSGFGIGGSIPIVYTYFTEFLQMDKRGEHLSWLCMFWMLGGL
YASFTAWGIIPHYGWGFAIGTQFQIHSWRVFILVCLFPALAALIGVVFMPESPRFLLENA
RHDEAWMILRRVHDTNWKAKGEPERVFTVTNIKTPQTEEDEFIEIQSDTGTAFQRWTVRK
MTMLQQKVMANVMSLSAPELRLQGLFLVIVWFCMAFSYHGLGVWFPDMIKYMQYEEYESK
VKVFHRERVERFHFNFSLVNQIHREGEYIHDKFANIEIKSVKFEDSLFENCHFEDVRSTN
TFFENCTFKNTIFYNTDLWQEKFKDCRLENTTFLHPKKGCHLNFQEENDIVIYMVSFLGS
LAVLPGNILSALFMDKIGRIRIIGGSMLASSACTFLLLLSFSQGAVICWQCLFYAVSVAA
WNGLEVISVELYPSSKRGTAFGILNGICKFAAILASFIFAVFIGITKIIPIFLAFAALVC
GGLVALKLPETREKILS
Download sequence
Identical sequences H2MI91
ENSORLP00000018365 8090.ENSORLP00000018365 ENSORLP00000018365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]