SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000018369 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000018369
Domain Number 1 Region: 41-145
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000014
Family Growth factor receptor domain 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000018369
Domain Number - Region: 150-212
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000128
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000018369   Gene: ENSORLG00000014653   Transcript: ENSORLT00000018370
Sequence length 227
Comment pep:known_by_projection chromosome:MEDAKA1:16:20925341:20932633:1 gene:ENSORLG00000014653 transcript:ENSORLT00000018370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLGLVALAMIILSSMGHSDVVKLSKARRQKRVSTEGPPSCPKGCDRCSEYNGCVKCKPK
LFIFLERNDIRQVGVCLASCPVGYFGMRNPEGNNRCTQCKIDNCEACFNRNFCTKCKEGL
YSHSGRCYVSCPPGQRTANETMECVGQHALKCELGKWSQWSSCMKKNKTCGFKKGSQFRV
RVPLQQTYAADSSSTLEETCTSQSERRKCVVPKTPCVKAARQMKGGH
Download sequence
Identical sequences H2MI95
ENSORLP00000018369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]