SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000018383 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000018383
Domain Number 1 Region: 27-90
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000523
Family VWC domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000018383   Gene: ENSORLG00000014658   Transcript: ENSORLT00000018384
Sequence length 1464
Comment pep:known_by_projection chromosome:MEDAKA1:21:17551464:17571248:-1 gene:ENSORLG00000014658 transcript:ENSORLT00000018384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFKHLACKLLVCFFDSTQSVVLYSWACEDEKDCIADGQTYNNKDIWKPEPCRICACDNGR
VICDEIQCEELRNCDGVIIPEGECCPVCQGDSPDQGNGRVAKGQKGEPGDVPLVTGIRGR
PGPMGPPGSPGDRGLRGHKGRPGLRGPPGFDGEPGIPGQPGEPGPPGPPPQHGVGGYMAE
GFGGKTGPQAMLNGARGEAGTRGPPGPNGSPGQAGPQGSPGDVGEPGHMGPPGQRGPEGP
PGKPGEDGEAGKAGNPGEVGFPGSAGPRGFPGTPGPPGIKGHRGHAGPIGLKGETGSVGS
KGATGGRGPMGAPGPMGPAGMPGERGRPGPSGVPGKRGSPGNLGKPGPMGPLGLSGPPGY
PGTPGMKGQPGPTGVRGPEGPQGQRGETGRQGSPGPVGLRGPVGGDGGPGTKGPVGNVGP
QGPGGHSGPPGPPGPQGSTGQPGIKGQGGDVGVPGFKGDAGPKGEPGPPGSQGVIGPQGE
EGKRGLRGDPGSVGPIGPVGERGAPGNRGFPGADGLPGPKIKGAQGDRGTSGPPGPKGSL
GDPGRPGEPGLPGARGLTGTPGVQGAEGKPGPLGAPGEDGRPGPAGSIGNRGPAGTMGVP
GPKGFSGDQGKTGEQGSAGVPGQRGPPGKDGEVGPAGPPGPSGVAGERGEQGPPGVNGFQ
GLPGNQGPPGEPGKPGDQGIPGELGPVGQVGPRGERGIPGERGELGSSGLQGPKGIPGAP
GPDGPKGSPGPTGALGDMGPPGLQGMPGERGISGPPGPKGDRGAIGEKGSEGTPGNDGAR
GTPGPVGPAGPAGPSGEKGEPGPKGPLGPPGSRGIHGARGDPGPIGAVGFAGPPGPDGQP
GVKGEPGEQGQKGDAGSPGPQGLAGAHGPHGPVGVAGLKGGRGTQGAPGPTGFPGSAGRV
GPPGPTGPVGEAGAPGPPGKEGPPGLRGDHGPPGRQGERGPAGPPGSPGDKGDGGEDGPT
GPDGPPGPAGTTGQRGIVGLPGQRGERGMPGLPGPGGPPGKQGAPGPSGDKGPSGPVGVP
GATGPRGDPGPEGPAGTDGPPGKDGLPGQRGDRGDLGPEGLIGPQGLPGPNGPVGAPGDP
GKRGEPGSRGPQGPPGQAGKRGLGGPQGPRGDKGDLGDHGERGQKGHRGFTGLQGLPGPP
GTTGEQGAPGIVGPGGPRGPPGPVGPPGKEGYMGQSGPMGPPGTRGLSGEIGPEGPPGEP
GPPGPPGPPGPPIAAMDDLFAGLHDYDSGIPPPPEFSEDEAMPNSNSTTIVPIDPGVQAT
LKALSSQIDSMKSPDGSKKHPARTCDDLKRCYPMKKSGEYWVDPNQGSAEDAIKVHCNMD
TGETCISANPSSIPRKVWWSSSRNKPVWFGADINRGTHFTYGNQDQPVNSVTVQMTFIRL
LSKEASQTITYHCKNSVAYKDQKNGNLKKAAILKGSNDLELKAEGNNRFRYTVLEDSCTQ
SNGNWGKTVFEYRTQKTARLPIVD
Download sequence
Identical sequences H2MIA9
ENSORLP00000018383 8090.ENSORLP00000018383 ENSORLP00000018383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]