SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000018404 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000018404
Domain Number 1 Region: 499-686
Classification Level Classification E-value
Superfamily Fibronectin type III 4.01e-29
Family Fibronectin type III 0.0000425
Further Details:      
 
Domain Number 2 Region: 216-302
Classification Level Classification E-value
Superfamily Immunoglobulin 8.14e-22
Family I set domains 0.00053
Further Details:      
 
Domain Number 3 Region: 292-403
Classification Level Classification E-value
Superfamily Immunoglobulin 2.4e-19
Family I set domains 0.0084
Further Details:      
 
Domain Number 4 Region: 405-504
Classification Level Classification E-value
Superfamily Immunoglobulin 2.11e-17
Family I set domains 0.028
Further Details:      
 
Domain Number 5 Region: 112-206
Classification Level Classification E-value
Superfamily Immunoglobulin 3.38e-17
Family I set domains 0.00035
Further Details:      
 
Domain Number 6 Region: 18-106
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000129
Family I set domains 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000018404   Gene: ENSORLG00000014681   Transcript: ENSORLT00000018405
Sequence length 901
Comment pep:known_by_projection chromosome:MEDAKA1:14:29382768:29464062:-1 gene:ENSORLG00000014681 transcript:ENSORLT00000018405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFFSIFFFFLHPAAIQVQITPAQGEISVGESKFFLCEVTGEVKDIDWYTPSGEKILHSMQ
DLSVSRSDEVTSTLTIYHANVDSAGIYKCVARDGEKEAQATVQVKIFQKITFQSAPSPQE
FTEGDTADIVCNVVSSPPPTIIWKHKGSKIQASKDVRYKIMANGHLQIRGIKKTDEGMYT
CEARVMARGEIDFKTMKVVVNVSVLPTIRARQFEVNATADIGNSALLACDADGFPDPIVT
WTHNNVVLEEGDKYSLNEDGSELIIKDVMKVDEGDYTCIAKNKAGEKSQEVSLNVFVQPK
ITYLNNKTAIEFDEEVILTCEASGDPTPTISWSSESKIFTEGEQASWTRPDKYESLDRNI
VVYSHARVSSLTLKNVQFTYAGQYLCIASNSIGQDSQSVYLEVRYSPKIQGVVASYTWEK
NPANLSCEVDAHPEASVVWFKDGSHLPSPNTTNVKIYNMPTVSYLEITPESQIDFGNYNC
TATNDLGSESKEFILIQADVPSAPEIQQVEPFSSTAMVEFEEPDSTGGVPVLKYKVEWRF
PGEEWARKEYSKEDGKTKILVTGLKPETTYEVKMSAINGKGEGESSAASFFKTKPVPWEP
SAPKLEANVADEGNSLRVTWIKQDDGGLPIIHYLVKYKAKHVPEWKPEIRVPSLSEHTTL
NGLAWNTEYEVHVVAENQQGRSEPGIVSIKTAAQPTAIPGSAHGGSGLGTGAIVGILIVV
FFLLLVGVDVTCYFLNKCGLLMCIAVNVCGKAGPGAKSKDIEEGNAAFTKDESKEPIVEV
RTEEHSPNQEVKTPSSEPNETTPLTEAERHRPSVTETTPLVVKILPSTAANSVSESFSTA
QSSPASESTTLTISTSSPTKAAPSTASPNSSSAAPPGSGKTDPQPNVGPLVDLSDSPKAD
P
Download sequence
Identical sequences H2MIC7
ENSORLP00000018404 ENSORLP00000018404 8090.ENSORLP00000018404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]