SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000018408 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000018408
Domain Number 1 Region: 87-94,291-345
Classification Level Classification E-value
Superfamily SH3-domain 5.12e-18
Family SH3-domain 0.001
Further Details:      
 
Domain Number 2 Region: 103-159
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000224
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0035
Further Details:      
 
Domain Number 3 Region: 350-405
Classification Level Classification E-value
Superfamily SH3-domain 0.0000427
Family SH3-domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000018408   Gene: ENSORLG00000014686   Transcript: ENSORLT00000018409
Sequence length 406
Comment pep:known_by_projection chromosome:MEDAKA1:22:9593220:9622489:1 gene:ENSORLG00000014686 transcript:ENSORLT00000018409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPPANTIQDDSGGNEEDRDQDETPKSPTTSNSQKETKLQRLKRSLSFKTKSIRSKSADN
FFRNSSENKTELLSDHTTNLPIPPVPPAIPCAPPPTSRSQSRNPLQVDSAGHCFMEHIFK
KPTFCDVCNHMIVGNTAKHGLRCKSCKMSLHHKCENGVGQQRCMGKLPKGFRRYYSSPLL
IQEQYGCIKEVLPIACGNKVDPVYEALRFGTSLAQKAKRASGSDSPNRNSISELDKVSEE
VLAHSSRQELSRKHSDDVFTVFENGTERYHLTDRKYEDGYPNQLQRDMLKLNTYVALYDY
AAQGSHDLEMRAGDRILLVDDSNNDWWKGVIEDRIGFFPSAFAHQLRAEEQVFRCNRAFI
GCKEQSQLTLKKGQICVGSEIERNGFIRVTSGKKRGYVPCDVLEII
Download sequence
Identical sequences H2MID1
ENSORLP00000018408 ENSORLP00000018408 8090.ENSORLP00000018408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]