SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000018516 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000018516
Domain Number 1 Region: 586-643
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000000474
Family BSTI 0.034
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000018516
Domain Number - Region: 247-298
Classification Level Classification E-value
Superfamily FnI-like domain 0.000241
Family Fibronectin type I module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000018516   Gene: ENSORLG00000014771   Transcript: ENSORLT00000018517
Sequence length 739
Comment pep:novel chromosome:MEDAKA1:14:30399001:30412600:1 gene:ENSORLG00000014771 transcript:ENSORLT00000018517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WTVFIYNPSAAITQDILYPYGPGYRDLETPKMDDGSSPEITLLIPFIFFNVPYRSIYVNN
NGVISFNVQVSQFTPEAFPLSDSRSFIAPLWADVHNGIRGDVYYRETADPEILERATQDV
RKHFKNMPSFTATWVFIATWHQVTFYGGSQTTPVNTFQTVLISDGVAFFSMFNYGQITWS
TGTASGGDPLTGLGGTTAQSGFNGGDINHFFNLPGSRSNDVVNIEQTTNVNIPGRWFFRI
DTELIDPANGCSYNGRFYRRGEIFWMSDQCSQRCRCLDINNEVQCLEAPCGQFETCEQQD
GAFYCQPTRTSTCVVFGDPHYHTFDGFLYHFQGTCSYLLARPCWEMAGMPFFSVEAKNEN
RGSATVSWLRDVTVEVYGHRVMIPKGSLGSVQVKNLQKTLPVQLQLGAVRVYQSGVAIAL
ETDFGLLVTYDGQHYASISLPSSYFNNTCGLCGNYNDDPADDPVLPDGSMAENLAELGGS
WRAEDTDWRCTDGCIENCSMCDPATEAFYFRSDYCGLINKTDGPFRDCRAVVDPTAFVYS
CVYDMCSNRDNMTTLCQAIQAYALACQALGVTIRPWRTRTFCGETFPCPEFSHYEVCTSA
CPASCSDLTAPLYCAHPCTEGCQCDTGYVLSGSRCVQPDDCGCEHNNLYYPLNGTFWASH
NCSKRCQCIGRNLVQCDPRRCKTEEECTLRYGVRGCFVRRPQNCIASSGGVFRTFDGASL
RLPASCSFVLSTNCHKLPD
Download sequence
Identical sequences H2MIN4
ENSORLP00000018516 ENSORLP00000018516 8090.ENSORLP00000018516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]