SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000018569 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000018569
Domain Number 1 Region: 562-625
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000542
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 490-536
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000144
Family TSP-1 type 1 repeat 0.00072
Further Details:      
 
Domain Number 3 Region: 83-123
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000089
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 4 Region: 31-79
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000124
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 5 Region: 621-675
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000195
Family Complement control module/SCR domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000018569   Gene: ENSORLG00000014812   Transcript: ENSORLT00000018570
Sequence length 814
Comment pep:known_by_projection chromosome:MEDAKA1:12:27434700:27462812:1 gene:ENSORLG00000014812 transcript:ENSORLT00000018570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSLFAAVCSPCVLILRDYTRFFAPPSGERPVNCRWGQYGSWSDCDGCTKTKVRTRHVEVF
AQFDGTPCSGEATERQSCAPQRACPLETGCGGRFRCTSGQCISQLLVCNGDQDCEDGLDE
RNCGRDDSHYSCDLHKTPPNSDFTGRGYDVLTDTFKAGVINTLSFGGQCRKVFSGDHKVT
YRLPQNILRYNFEVQVDNEESDESYLSSWSYMQDVQSNALIGHDRRSFHKELSDSKAYRI
IILKNKVALAQFQNSAPDYLPLSESFWKDLSSLPLTYDYSAYRRLLQTYGTHYLAEGVLG
GEYQGLLELDQHAFTSTSTTDIEYQRCWRKVKRFLFFKKVKTVCEKLKKTLSSSSHSSGE
KLRIKVKTFGGDPSFLNVLSELNLETPEVNGETYNNWASSVKDFPDVIDQKLRPLHELVK
EVHCAALKKLHLKMATEEYLAEQHPCHCRPCQNNGRPLLTGSVCRCVCRPGTSGSACQTG
SVIGEQPGVIHGSWSCWSSWSSCSEGQRSRSRSCNNPAPRNGGHSCIGPAAEQKSCEEPG
ILHLQMMAPQCFGLSIAPPKTCGPPPGLRNGFVTNPKDFYLVGQRVEYSCIEGFYLSGDA
VATCADDQTWRTGAKLCKSSTCGTPPVKGLVLATPSKAVYQIGESVSLSCPEGSVLSSEE
STIMCTPSLQWSPSPGDIHCEAVPLLLAPPAPPKCKVWENVGERGCVCKMTFHCLTSLTL
CAKVGSRHMLLGLCRLGALRCLGRNFTVVRDQDCDWPEGRCLCQEASKCPADSAPVCVSS
GEDGVRVTMTECEVGAKRCAGERLHVLDIDACPA
Download sequence
Identical sequences H2MIT6
ENSORLP00000018569 ENSORLP00000018569 8090.ENSORLP00000018569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]