SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000018612 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000018612
Domain Number 1 Region: 647-712
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000361
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 2 Region: 568-616
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000916
Family TSP-1 type 1 repeat 0.00071
Further Details:      
 
Domain Number 3 Region: 143-183
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000877
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 4 Region: 81-129
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000575
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 5 Region: 25-79
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000379
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 6 Region: 702-761
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000486
Family Complement control module/SCR domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000018612   Gene: ENSORLG00000014843   Transcript: ENSORLT00000018613
Sequence length 939
Comment pep:known_by_projection chromosome:MEDAKA1:12:27464701:27480125:-1 gene:ENSORLG00000014843 transcript:ENSORLT00000018613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPSNSLVLLLQLLSCVSVGLACFCDRYPWTSWSPCTQTCNHGVQNRRRQIHYDDYYWKN
SCHQLCDSQDVRACNEQPCHINCALTDYSQWSPCSSCAKKQYRTRSVETPSQFGGMQCSE
ELSEERPCYPSKECKLPDIDCRENFKCDNGRCINSTLRCNKQNDCGDNSDERDCNAFSIV
CPTKRQPAPGVDLVGNGFDALAEEPRGAVLDNMFMGENCIIKRPQSTTLYHRVPYNFESF
DIKVLADAVGMVEDFSTEPQPLHSESVSTKRSGSSSYSRGEKDFLSVLLYLGRGSGSTVQ
SNKEAFEASKKTDSKFFRVHQVLPVSKFKVKEPEDVVLSQTFLQFLHDLPLEYNYPRYRD
IFQRFGTHYYSSGSLGGHYDLLYQYSRQELITSGETEEHVQGCLFKETTWTVILYTEHSS
VTRCRNNRMTEKYSGSYIQSSEKSFSMVKGGQAREAAALAWERQGPAPDRTSYKNWAKSV
LHNPAVVDYKLRPLIELVRGIPCAATKRRHLRKALLQYLQEFDTCKCAPCPNNARPVLSG
TECKCVCQTGTFGTNCEKRAPDFTSEAVDGYWSCWGPWSSCGVTMRRSRSRRCDNPSPLK
GGEPCQGPDKQVEPCHVSLFEKQDSCDNDDDFTVGWRDELPPGVKGCLRPQRPPNSFLRI
AKPYYDVGEDEEFRCFTGFELEGFQFINCRSDGSWSPPSGRCYRNYCDPPQIPDTMTLFP
ISEAYKVGESVGLNCKEPGLTPLPQGFYKCTSSLTWEPPVPADLRCTDVVPVGPGGPCGP
GQKQQGSRCVCEDRESCLSEPDALCVLNVDLGFSVSMSLCSFYAGRCHGDPLFFVSEGAC
DPEDSSKLEQAKFRAQMCSKSSVHTPCGPDTCYDWETCSATKQCSCKKPRECAGYEGQMF
CVRMSVSQSTLSVNLCQMGLIRCNNRAFEIVSEGACASR
Download sequence
Identical sequences H2MIX9
ENSORLP00000018612 ENSORLP00000018612 8090.ENSORLP00000018612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]