SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000018982 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000018982
Domain Number 1 Region: 32-272,320-345
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 8.02e-61
Family BAR domain 0.0015
Further Details:      
 
Domain Number 2 Region: 437-541
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.96e-33
Family Pyk2-associated protein beta ARF-GAP domain 0.00000774
Further Details:      
 
Domain Number 3 Region: 318-425
Classification Level Classification E-value
Superfamily PH domain-like 4.11e-20
Family Pleckstrin-homology domain (PH domain) 0.0068
Further Details:      
 
Domain Number 4 Region: 644-714
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.57e-18
Family Ankyrin repeat 0.00012
Further Details:      
 
Domain Number 5 Region: 954-974,1074-1132
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000011
Family SH3-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000018982   Gene: ENSORLG00000015141   Transcript: ENSORLT00000018983
Sequence length 1134
Comment pep:known_by_projection chromosome:MEDAKA1:22:11052816:11114120:1 gene:ENSORLG00000015141 transcript:ENSORLT00000018983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPDQITVSEFVAETNEDYKSPTASNFTTRMSHCRNTVSALEEALDVDRSVLYKMKKSVKA
IHASGLVKMQFEKNIIQLLDKIFFGSCFLEKQKTNLRTAFLKFSVFTKEVTALFKNLFQN
MNNIITFPLDSLLKGDLKGVKGDLKKPFDKSWKDYETKVTKIEKEKKEHARQHGMIRTEI
SGAEIAEEMEKERRFFQLQMCEYLLKVNEIKIKKGVDLLQNLIKYFYAQCNFFQDGLKAV
DNLKPSMEKLSTDLQSIKQVQDEERKQLTQLRDVLKSALQVEQKELVSVTLENPKNKSRR
DSQVRQSTTYSLHQPQGNKEHGTERSGFLFKKSDGLRKVWQKRKCATKNGYLTISHGTAN
RPPAKLNLLTCQVKHNPEEKRSFDLISHDRTYHFQAEDDQDCQIWISVLQNSKEEALNQA
FKGDQHVGENNIVQELTKAILAEVKRMTGNNLCCDCGAPNPTWLSTNLGILTCIECSGIH
RELGVHYSRIQSLTLDVLSTSELLLAKNVGNAGFNEIMEARLSAENVMKPNPASDILGVK
SLHMVHIIHTLNTFILADNLLFLLVLCSDFKGFWGKPFISVLLHYLRSASHSLYAARGAL
TLLTHTRVRFQQQTHILVLQELTVNHCQSICAMSPAQNTCNLPNLHRCSDRWKGCILRFK
MREKKASIDIANEAGETPLDIARRLRHLQCEELLNQALAGKFNGHVHVEYEWRLQHEDLD
ESDEDLDEKPSPLRRDERPVSCYTPSSNSHPPSSVGSAGRDPKDKQRSYMPSMVNNETYG
AVLDAGSTQPAASGPPLPPRNLGKSEINSSPFPSPVGQLSALGGIGQPSASSGWKSGPLD
MVGRQRSSSDPPNMHPPIPPLRLTSNAGKFGSGLAHPLAGKMETMNLQAKSGQGPPGSRG
VPPKSPAGKLKPRFYFSLTACDLPQYLFLLEAWKVFFSRNFPFPVPAKEVPGCPQNSVGQ
SPPPAPMPIPVPDVWMIPSRLFTVFSRCRLSNQFLFSSPELKFSLYKHENADIFKKLSLA
SVFSVLNEEKISEKYIKNNLSVLFLFKMHNTDKVPTLWTEHFVCFILVLQKQKPKRVKAI
YNCVADNPDELTFSEGEVIVVDGEEDQEWWLGHIEGDPLRRGAFPVSFIHFIVD
Download sequence
Identical sequences H2MJY0
ENSORLP00000018982 ENSORLP00000018982 8090.ENSORLP00000018982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]