SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000018985 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000018985
Domain Number 1 Region: 298-500
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.78e-52
Family Reprolysin-like 0.00036
Further Details:      
 
Domain Number 2 Region: 591-647
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000863
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 3 Region: 931-988
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000497
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number 4 Region: 1132-1182
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000719
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 5 Region: 991-1049
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000419
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 6 Region: 1056-1116
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000719
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000018985
Domain Number - Region: 880-928
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00562
Family TSP-1 type 1 repeat 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000018985   Gene: ENSORLG00000015149   Transcript: ENSORLT00000018986
Sequence length 1226
Comment pep:known_by_projection chromosome:MEDAKA1:3:32924881:32983862:1 gene:ENSORLG00000015149 transcript:ENSORLT00000018986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDYLFLLIWTLPVPLVGCTSVRLLSTLLSWNIIKTLHIYCTHSVLASSSFSSSHGLNHDY
IIVTPVEVDSDGAYLTHDVGRRSHRSRRSLSSSLHYSFSAFGQDLHLDLRPSSVVGPGFT
VQTLGSGGISTVTGDAGFRNCLYQGFIRNLSESSAAISTCSGLSGLIRVSQEDYLLAPLP
QHLAEQHNYSAPAGHHPHVVYRRSADHIVHRKTRSSSGSSSSRSDDSYLHHLQRQQSFGS
QPGKLQRRHFCGRRKQYTPKPPAENLFIMPDEYATPEAGEPARAKRSPINSNRVGGLNVE
TLVVADRKMLEKHGRENVTTYVLTVMNMVSSLFKDGTIGTDINIVVVSLLLLEQDPLGLT
VNHHADQSLNSFCQWQSGLVGKGGKRHDHAILLTGLDICSWKNEPCDTLGFAPISGMCSK
YRSCTINEDTGLGLAFTIAHESGHNFGMIHDGEGNPCRKTEGNIMSPTLAGNNGVFSWST
CSRQYLSRFLGTAQASCLGDEPKQIGQYKYPEQLPGQLYDADTQCKWQFGSKTKLCSLDF
VKDICKSLWCHRAGHRCETKFMPAAEGTTCGPDMWCRKGQCVKYGDHGPRAIHGQWSAWS
QWSDCSRTCGGGVMYRERSCNSPRPQNNGKFCPGSGRLNQLCNPQSCPVNAVDFRAQQCS
EYNSKPFRGWYYKWKPYTKVDDEDICKLYCIAEDYDFFFAMSSKVKDGTPCYDHKGDVCV
DGVCEAVGCDRILGSKAFVDACGVCKGDNSTCKFFKGQYTLQHRANEYYSMVTVPAGARS
IRIQEMEVSTSYLAVRSLKRRYYLTGDWTVDWPGKFLFGGTVFDYQRSFNKPESLYAAGP
TNETLVFEILLQGQNPGVMWEYSLSRTERKPEYSWGVVRSDCSAPCAGGRISTKAICLQD
QKTQVNSSMCNPHSRPTLGSHLCNTQPCPAYWAAADWGPCSRSCGGGQQTRTLRCLRKVT
YQREEVVALSLCPAISPAQIQPCNTQACPPEWSTGSWSQCSKSCGRGLRKRSVFCRSTDP
GIKAVVVPDSMCKQHHRPKAQETCVLRRCPRNEKLQWMLTPWEECSRSCGSGNQRRELRC
GERDAHGGFVEFPVRRCRNLAKPLVDLQQLCNRGPCQELVPGRASSTVVLGWYSSPWQQC
SVSCGGGVQTRSIQCLRQGRPAAGCLPHQKPVTSRACNTHFCPAAQRPAEELCVDQFSWC
HLVPQHGVCNHKFYGQQCCKSCSSKK
Download sequence
Identical sequences H2MJY3
8090.ENSORLP00000018985 ENSORLP00000018985 ENSORLP00000018985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]