SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000019010 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000019010
Domain Number 1 Region: 446-677
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.74e-48
Family Eukaryotic proteases 0.0000261
Further Details:      
 
Domain Number 2 Region: 181-264
Classification Level Classification E-value
Superfamily Kringle-like 1.64e-34
Family Kringle modules 0.0000948
Further Details:      
 
Domain Number 3 Region: 272-355
Classification Level Classification E-value
Superfamily Kringle-like 3.87e-28
Family Kringle modules 0.00024
Further Details:      
 
Domain Number 4 Region: 88-180
Classification Level Classification E-value
Superfamily Kringle-like 1.04e-27
Family Kringle modules 0.00028
Further Details:      
 
Domain Number 5 Region: 361-457
Classification Level Classification E-value
Superfamily Kringle-like 1.72e-26
Family Kringle modules 0.0005
Further Details:      
 
Domain Number 6 Region: 2-50
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000000381
Family Hairpin loop containing domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000019010   Gene: ENSORLG00000015173   Transcript: ENSORLT00000019011
Sequence length 685
Comment pep:known_by_projection chromosome:MEDAKA1:23:16127724:16143102:1 gene:ENSORLG00000015173 transcript:ENSORLT00000019011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RQLLQKYEKTENYMLVCTDCHQQPVVRNGRSQEHCARKCKKVKGNFNCRFGFFFFGVYHL
ETYQLPPLCFCKAFNFYRNENTHSDVCILCFFLDYVRECITSTKDNYRGRRSWTKSNIIC
QAWSDSNINEHTFYPDRYPTQDLRDNFCRNPNNDPGGPWCYTTDPNVRAEECGIPHCSEE
VCMTCNGEDYRGKVDHTESGRECQRWDSPRPHRHQFQPKKFRDKDLKDNYCRNPDNRLRP
WCFTMDPKTPWEYCDIAVCDSVPTVGLDVNITTSCVQGVGTNYQGTMNATPEGVTCQRWD
SQFPHNHSFLPEHFKCKNLTENHCRNPDGADYPWCFTTDPKQRIAKCTHIPRCDAEAKRK
TECYEGSGELYRGTLSKTRSGIPCADWSLHINSKDSHSTISHVGLEKNYCRNPDRDKHGP
WCYTSQNNRLVWDYCKLKQSSPRPKVSCFVHINTRIVGGHQVRGTDGSWVVSIQREKVHL
CGGSLIREDWVLTDQQCFTSCVPDLKEYSVQVGLHHLNESSNHPRLRISRLICGPKGSNL
VMLKLEDPAPVSEGASTIHLPVKECHINQGTNCTMYGWGETKNRGQEETLNSVTMAMADN
EMCSRIKGDLGESRICAGGKIGEGVCDRDYGGPLVCQEHEHKVIIGVSIQRTKCASSQPA
LFVNVAFYSEWIYKVFRLYPTLDTN
Download sequence
Identical sequences H2MK06
ENSORLP00000019010 ENSORLP00000019010 8090.ENSORLP00000019010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]