SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000019268 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000019268
Domain Number 1 Region: 162-435
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.38e-51
Family FCH domain 0.006
Further Details:      
 
Domain Number 2 Region: 637-720,753-850
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.29e-50
Family BCR-homology GTPase activation domain (BH-domain) 0.00011
Further Details:      
 
Domain Number 3 Region: 563-616
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000164
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000019268   Gene: ENSORLG00000015393   Transcript: ENSORLT00000019269
Sequence length 850
Comment pep:known_by_projection chromosome:MEDAKA1:4:28387287:28398511:-1 gene:ENSORLG00000015393 transcript:ENSORLT00000019269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCLNSSAILLPPLLIQRCSHAGKESQRPVAHECLGEVLRNLRQVINTYPLLNTVEILTAA
GKLISKVKGFHYEACNEADKMDFEKAIETIAVAFSSNVSELLMGEVDSSTLLSLLPTEKS
RSMENLYAAAGGQGGDGGHFKNDLQDLGRVEEVDVILQHSEGGVDSALLYAKSTAKYMKD
LISYVEKRTSLEMEFSKGLQKLYQSCKHSITHPHMPLFSIYSLALEQDQEQSVGLQQASN
TLQSQTFQPLTQRKQEHEKKRKEIKENWFRARRKLLECEANLRKAKQAYMARCEEYEKAK
TATCRAEEEGTGSTAKSVEKKKRLEEEARNKAVEAEATYRTCIADATTQQLELEHTKVTV
LRQLQDIIKQSDQTLRSATISYYQLMHMQTVALPVHYQTLCESSKLYDPGQQYAAHVRDL
QLPGQPTVHYVFETYSPSSSGTSHGHRPRNDSFNTDPPSECPVISVEASSGNAEAQRKKQ
GHKSWGSTISNDSVGGDGGIDFLNASTSDIEKIARTSSTGTMSSDEDADEKDGNVSSFET
NMNGMDPDVVVSTRPFRNIGLSKAAKTHRLRKLRAPSKCRECDSYVYFQGAECEECFLAC
HKRCLETLAIQCGHKKLQGRLQLFGRDFAQVAGCASDCIPFIITKCISEIERRALKMKGI
YRVNGVKTRVEKLCQAFENGKELVELSQCSPHDISNVLKLYLRQLPEPIMPFRLYNTLMG
MAKESLHGEGEESEPSAINPAVSRGPELIDLGPDTDPDVLALVDSLKEILKELPKANFAT
LRYIIHHLRRIAELEEENKMSPSNLGIVFGPSLIRPRPTGATISLSSLVDYPHQARIVEA
LIVFYSSIFQ
Download sequence
Identical sequences H2MKP8
ENSORLP00000019268 ENSORLP00000019268 8090.ENSORLP00000019268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]