SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000019394 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000019394
Domain Number 1 Region: 157-224
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000251
Family VWC domain 0.0081
Further Details:      
 
Domain Number 2 Region: 279-355
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000126
Family VWC domain 0.023
Further Details:      
 
Domain Number 3 Region: 631-688
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000327
Family BSTI 0.055
Further Details:      
 
Domain Number 4 Region: 97-164
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000387
Family VWC domain 0.0062
Further Details:      
 
Domain Number 5 Region: 234-288
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000251
Family VWC domain 0.02
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000019394
Domain Number - Region: 48-104
Classification Level Classification E-value
Superfamily FnI-like domain 0.000178
Family VWC domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000019394   Gene: ENSORLG00000015488   Transcript: ENSORLT00000019395
Sequence length 690
Comment pep:known_by_projection chromosome:MEDAKA1:16:23566480:23601653:1 gene:ENSORLG00000015488 transcript:ENSORLT00000019395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YVWFSVVSALPFCFCYLCGFMPSAVLLILTCSGAANSLLSFSGTEASCENEGEVLHIPNI
TDNPCITCVCLDGKADCKQEKCQPVSEDCALVVKQTGACCERCKGCTLDGRSHNSSESWI
SSTKPCKSSRCQEGVITEAEVQCVIHCRNPKTHPKKCCPTCPGCILEGHLYKEMEEFSPE
GKPCIKCTCSGGRTLCMKEVCPVLSCPAYLSHTPAGQCCPTCIGQRKVFDLSLGSCLFHS
EVYENGTSFLHDNCTTCTCKDSTVVCKKSCSRPGSCQGNQCCDPCVSYVKVEEVQYCRVR
NKIYREGDMWSSMNCTLCACVKGSIECRPKKCVPITSCPPNKILNRTGCCPVCTEKPGVC
TVFGDPHYNTFDGRTFNFQGTCQYVLTQDCGGSPSGLENNPDSNFMVLVKNYARRTRHFS
WTQSVEVRLGSVILSLHQHLTVRRNGTRIALPYHGPGVHIDLDGYLLKLTSIAGLEITWD
GDSFVEVVAAPHLRGRLCGLCGNYNGHKRDDTMGGDGQLKFDVDEFAESWRVEGNEVCSQ
HQPRRPSSFLCPGSPKVKFRAHRECQRIKSWDFQKCHSVVDFAPFYRSCITDMCECPIHK
NCYCESFIAYSRACEREGVVVQWKPDNVCMATQCKHDAVYDTCGPGCTKTCDNWNEIGPC
QKPCVAGCHCPANLVLFHGRCIKPTACPGR
Download sequence
Identical sequences H2ML23
8090.ENSORLP00000019394 ENSORLP00000019394 ENSORLP00000019394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]