SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000019496 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000019496
Domain Number 1 Region: 328-492,882-1057
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.67e-112
Family Mammalian PLC 0.00000697
Further Details:      
 
Domain Number 2 Region: 654-751,811-836
Classification Level Classification E-value
Superfamily SH2 domain 6.78e-30
Family SH2 domain 0.0000344
Further Details:      
 
Domain Number 3 Region: 535-651
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-23
Family SH2 domain 0.00069
Further Details:      
 
Domain Number 4 Region: 1073-1193
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.34e-22
Family PLC-like (P variant) 0.0051
Further Details:      
 
Domain Number 5 Region: 40-143
Classification Level Classification E-value
Superfamily PH domain-like 3.84e-16
Family Pleckstrin-homology domain (PH domain) 0.0093
Further Details:      
 
Domain Number 6 Region: 768-840
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000307
Family SH3-domain 0.00028
Further Details:      
 
Domain Number 7 Region: 157-319
Classification Level Classification E-value
Superfamily EF-hand 0.0000000124
Family Calmodulin-like 0.034
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000019496
Domain Number - Region: 482-523
Classification Level Classification E-value
Superfamily PH domain-like 0.00011
Family Pleckstrin-homology domain (PH domain) 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000019496   Gene: ENSORLG00000015570   Transcript: ENSORLT00000019497
Sequence length 1263
Comment pep:known_by_projection chromosome:MEDAKA1:6:23233035:23264776:-1 gene:ENSORLG00000015570 transcript:ENSORLT00000019497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALHLMSFSPERPTLIVSGTFKQGEMTEYRKILIKRDLEMGVVMTVFRQKAERLTVQVIME
TRQVAWTRTADKTDGVLDLLEIREIRPGRNSKDFERFKDGKDKHGENTCFTIFYGSQFVL
STLSLGADSVDEAQKWLTGLEMLRQETQAAPTPVLIESWLRKQMYSVNQNKTNSISVKEL
KSLLPVLNYKAPSSRTFKDKLLEVGIKKDRLDFEQFHKFYNLIMFEQNENQILDEFKREA
CSFILGNTDKPDASAVLLHDFQRFLIYDQKESWANNLNQVRELMTTFIDDTMRRTNDPEF
TVSEFLGFLFSKENAVWDEKYSEINNLNMNNPLSHYWINSSHNTYLTGDQLRSESSTEAY
VRCLRLGCRCVELDCWEGPGEPIIYHGWTRTTKIKFEDVVKAINEHAFVTSDFPLILSIE
EHCPIEQQRQMARIFKEVFGDKLLTEPVEHMAEQLPSPTQLKGKIVLKHKKLNVEGGGFT
KDFRKGQKQGDLEIWDPVDQRWNKHYCVISDDKLYYAEEYEQEEEDPKKVKVAQYQDMHC
SEPWFHGQMKEGRQMAERRIHEYCTETGRRDGTFLVRQSDTYVTDYTLSFWRGGRVQHCR
IRSGSEGGHTYFFLTPNLHFPTVYSLIQHYKDMPLRCQDFELRLTDAVPKPDSHLQEGWF
YSNLSRGQAEDYLLRIPRDGAFLIRQREGEPDSFAITFRGDGKVKHCRIQKEGGMFLLGS
TTEFESLVELVNYYKKKPLYRKIKLRYPVTPELVQRFITDDKCASLYEIKTYVDPNEIEP
AVPQNTVKAIYSYTAKRQDELSFSKGALIHNVFKESEGWWRGDCGGRIQLFFPANYVEEV
FDQRQADTKSKEMEDNPLGELCKGIVDLSKCNIQHLKSGKSGKSHVLTVNNTDLDSVQFD
LAADSLEELFEWYTVAWDISQRAISNKYNKDKEVEKKAEVAMEMSDLVVYCQPRSKEKDR
FDSYTYKEVRSFIENKLPNKSRTKEFLQYNRKALSRIYPKSQRVESSNYDPYPMWAVGCH
MVALNFQTADKCTQLNTALFNLNGRTGYVLQPELMRSDTYDPYQEKKKVKYHIKLKVIAA
RHLPRPGRSIASPFVEVELCGHTEEKFKTIVYHDNGLNPVWKSPAEPVEFTVYEPELTFL
RFVVNEEDMFSDPNFLAQATFPVIGLRSGYRSVPLKNGFSENLELASLLIYISVNQAGRV
QEDLYSSSRQLKSEQAEKSEPFLYDTHNNISRSSLPREFNPLVRDASERHKKEKKTNSSK
FYS
Download sequence
Identical sequences H2MLC0
ENSORLP00000019496 ENSORLP00000019496 8090.ENSORLP00000019496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]