SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000019657 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000019657
Domain Number 1 Region: 31-110
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000003
Family V set domains (antibody variable domain-like) 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000019657   Gene: ENSORLG00000015699   Transcript: ENSORLT00000019658
Sequence length 200
Comment pep:novel chromosome:MEDAKA1:24:11537060:11614430:-1 gene:ENSORLG00000015699 transcript:ENSORLT00000019658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLLKLLTIFMLQVGVSLAGFIPQFDMKFKRVGEDVLLNCPVKESSDQCSNSTWSFNRP
SDDRNMKRMIFEENTDQSSAGDSRLSLSRNCSLLIRNLTAEDGGVYGCHNEMAVLLGILS
ITSSPPDVNGWVDLTCSLKGLQKPGQCGPRLIFWVDETGTPLSDKTPEFEVKQTNICDLV
LSVKHQSGNNKRFTCQLIAY
Download sequence
Identical sequences H2MLS3
ENSORLP00000019657 ENSORLP00000019657 8090.ENSORLP00000019657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]