SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000019756 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000019756
Domain Number 1 Region: 38-504
Classification Level Classification E-value
Superfamily Sema domain 5.36e-129
Family Sema domain 0.0000246
Further Details:      
 
Domain Number 2 Region: 950-1039
Classification Level Classification E-value
Superfamily E set domains 8.53e-18
Family Other IPT/TIG domains 0.015
Further Details:      
 
Domain Number 3 Region: 854-949
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000887
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 4 Region: 1038-1140
Classification Level Classification E-value
Superfamily E set domains 0.000000000000994
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.061
Further Details:      
 
Domain Number 5 Region: 507-557
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000222
Family Plexin repeat 0.0018
Further Details:      
 
Domain Number 6 Region: 803-837
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000034
Family Plexin repeat 0.0035
Further Details:      
 
Domain Number 7 Region: 1146-1222
Classification Level Classification E-value
Superfamily E set domains 0.00000482
Family E-set domains of sugar-utilizing enzymes 0.041
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000019756
Domain Number - Region: 1350-1427
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.000243
Family p120GAP domain-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000019756   Gene: ENSORLG00000015772   Transcript: ENSORLT00000019757
Sequence length 1427
Comment pep:known_by_projection chromosome:MEDAKA1:7:23220093:23390291:1 gene:ENSORLG00000015772 transcript:ENSORLT00000019757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPLTPKSFALLNLNCYSLSKMEGQWAARTTSSPYRTYERRDWVFNHLTVHQTTGSLYIGA
VNRVYKLSGNLTLLVSHDTGPEDDNKACYPPLIVQPCSEPLVSTSNVNKLLLIDYSQNRL
LACGSLYQGVCKLLRLDDLFILVEPSHKKEHYLSSVNQTGTMYGVIVPSQGQDGTLFIGT
AVDGKQDYFPTISSRKLPRDPESSAMLDYEMHTDFVSSLIKIPSDTLALVSHFDIYYVYG
FASGNFVYFLTVQPEIPENSMSSSGSNNDLFYTSRIVRLCKDDRKFHSYVSLPIGCVKNG
VEYRLLQAAYLGKPGRILASSLGISAQDDVLFTVFSKGQKQFHRPPDDSALCVFTIREIN
ARIKERLQSCYQGEGNLELNWLLGKDVHCTKAPVPIDDSFCGLDINQPLGGSQLVTGHTL
FTETRDRMTSVVSYVYNGYCVAFVGTKSGRLKKIRVDGPPHGGAQYETVPVIKDGSPVLR
DMAFSLDRSFLYVMSERQVTQVPIESCEQYETCGECLSSGDPHCGWCVLHNMCSQKSRCE
RADEPYRFAASLNQCVKAAVYPDSIAVSEPSVPLLVKVSDVPDLSAGITCSFGNLTEVEG
QVNGNQILCVSPAAKDVPLIPTDQDWSGVDLRLNSKETGQMLISTEIKFYNCSVHQLCLS
CVNSAFLCHWCKYRNLCTHDPSSCSFQEGRVNTSEDCPQLVPSEEILIPVGEVKPITLKA
KNLPQPQSGQRGYECVLHIQGVSHRVTALRFNSSSVQCQNSSYLYEGMKISELPVEFSVV
WNGNFIIDNPENIKVHLYKCAAQRDSCGLCLKADRKFQCGWCSEEGRCTLRHHCPAINPY
TTRWLNLSSRNVKCTNPRITEVTPVAGPPEGGTRVTIYGTNLGLSFSDMEDNVQVAGVQC
TPVEDGYIIAEQIVCEMAAAPASSRPGPVQLCVGECKPELSTRSSHLYSFVTPTVTGLSP
SRGPESGGTKVTIMGENLGAGSTVNVQFGNQTCEFFRRTTTEIVCYSAPSLFGIGPVQIS
VRVDHARIRESLPFEYIEDPTVLRIEPDWSIASGNTPLMVTGTNLDVVQEPRIRVKYAGR
ESINVCKVLNTSTLSCFAPSLMVEYQPGLDTVKHADEFGFIFNNIQALLVYNNTNLLYYP
NPYFEPLSNTGVLEQKPGSPIILKGRNLVPPAAGGVKLNYTVLIGETPCSVTVSESQLLC
EPPNLTGQYKVVVQVGGLTVSPGAVHIMSDSLLTLPAIVSIAAGGGLLLIIVILVLIAYK
RKSRENDLTLKRLQMQMDNLESRVALECKEAFAELQTDINELTSDLDRAGIPHLDYRTYV
MRVLFPGIEDHPVLRELEVSGNGQQSVEKALKLFGQLINNKVFLLTFIRTLEMQRSFSMR
DRGNVASLIMTALQGRLEYATDVLKHLLSDLIDRNLESKNHPKLLLR
Download sequence
Identical sequences H2MM19
8090.ENSORLP00000019756 ENSORLP00000019756 ENSORLP00000019756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]