SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000019757 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000019757
Domain Number 1 Region: 23-494
Classification Level Classification E-value
Superfamily Sema domain 2.75e-129
Family Sema domain 0.0000241
Further Details:      
 
Domain Number 2 Region: 941-1030
Classification Level Classification E-value
Superfamily E set domains 8.4e-18
Family Other IPT/TIG domains 0.015
Further Details:      
 
Domain Number 3 Region: 845-940
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000871
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 4 Region: 1028-1131
Classification Level Classification E-value
Superfamily E set domains 0.000000000000574
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.061
Further Details:      
 
Domain Number 5 Region: 497-547
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000222
Family Plexin repeat 0.0018
Further Details:      
 
Domain Number 6 Region: 794-828
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000034
Family Plexin repeat 0.0035
Further Details:      
 
Domain Number 7 Region: 1137-1213
Classification Level Classification E-value
Superfamily E set domains 0.00000467
Family E-set domains of sugar-utilizing enzymes 0.041
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000019757
Domain Number - Region: 1337-1414
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.000243
Family p120GAP domain-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000019757   Gene: ENSORLG00000015772   Transcript: ENSORLT00000019758
Sequence length 1414
Comment pep:known_by_projection chromosome:MEDAKA1:7:23220415:23390291:1 gene:ENSORLG00000015772 transcript:ENSORLT00000019758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATAALLGLWLLAVPAESSGQTFTSFHPERRDWVFNHLTVHQTTGSLYIGAVNRVYKLSGN
LTLLVSHDTGPEDDNKACYPPLIVQPCSEPLVSTSNVNKLLLIDYSQNRLLACGSLYQGV
CKLLRLDDLFILVEPSHKKEHYLSSVNQTGTMYGVIVPSQGQDGTLFIGTAVDGKQDYFP
TISSRKLPRDPESSAMLDYEMHTDFVSSLIKIPSDTLALVSHFDIYYVYGFASGNFVYFL
TVQPEIPENSMSSSGSNNDLFYTSRIVRLCKDDRKFHSYVSLPIGCVKNGVEYRLLQAAY
LGKPGRILASSLGISAQDDVLFTVFSKGQKQFHRPPDDSALCVFTIREINARIKERLQSC
YQGEGNLELNWLLGKDVHCTKAPVPIDDSFCGLDINQPLGGSQLVTGHTLFTETRDRMTS
VVSYVYNGYCVAFVGTKSGRLKKIRVDGPPHGGAQYETVPVIKDGSPVLRDMAFSLDRSF
LYVMSERQVTQVPIESCEQYETCGECLSSGDPHCGWCVLHNMCSQKSRCERADEPYRFAA
SLNQCVKAAVYPDSIAVSEPSVPLLVKVSDVPDLSAGITCSFGNLTEVEGQVNGNQILCV
SPAAKDVPLIPTDQAAFKGVDLRLNSKETGQMLISTEIKFYNCSVHQLCLSCVNSAFLCH
WCKYRNLCTHDPSSCSFQEGRVNTSEDCPQLVPSEEILIPVGEVKPITLKAKNLPQPQSG
QRGYECVLHIQGVSHRVTALRFNSSSVQCQNSSYLYEGMKISELPVEFSVVWNGNFIIDN
PENIKVHLYKCAAQRDSCGLCLKADRKFQCGWCSEEGRCTLRHHCPAINPYTTRWLNLSS
RNVKCTNPRITEVTPVAGPPEGGTRVTIYGTNLGLSFSDMEDNVQVAGVQCTPVEDGYII
AEQIVCEMAAAPASSRPGPVQLCVGECKPELSTRSSHLYSFVTPTVTGLSPSRGPESGGT
KVTIMGENLGAGSTVNVQFGNQTCEFFRRTTTEIVCYSAPSLFGIGPVQISVRVDHARIR
ESLPFEYIEDPTVLRIEPDWSIASGNTPLMVTGTNLDVVQEPRIRVKYAGRESINVCKVL
NTSTLSCFAPSLMVEYQPGLDTVKHADEFGFIFNNIQALLVYNNTNLLYYPNPYFEPLSN
TGVLEQKPGSPIILKGRNLVPPAAGGVKLNYTVLIGETPCSVTVSESQLLCEPPNLTGQY
KVVVQVGGLTVSPGAVHIMSDSLLTLPAIVSIAAGGGLLLIIVILVLIAYKRKSRENDLT
LKRLQMQMDNLESRVALECKEAFAELQTDINELTSDLDRAGIPHLDYRTYVMRVLFPGIE
DHPVLRELENPQSVEKALKLFGQLINNKVFLLTFIRTLEMQRSFSMRDRGNVASLIMTAL
QGRLEYATDVLKHLLSDLIDRNLESKNHPKLLLR
Download sequence
Identical sequences H2MM20
ENSORLP00000019757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]