SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000020072 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000020072
Domain Number 1 Region: 85-155
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000167
Family VWC domain 0.0089
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000020072
Domain Number - Region: 33-93
Classification Level Classification E-value
Superfamily FnI-like domain 0.000303
Family Fibronectin type I module 0.026
Further Details:      
 
Domain Number - Region: 153-198
Classification Level Classification E-value
Superfamily FnI-like domain 0.0262
Family Fibronectin type I module 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000020072   Gene: ENSORLG00000016037   Transcript: ENSORLT00000020073
Sequence length 204
Comment pep:known_by_projection chromosome:MEDAKA1:21:21208625:21235935:1 gene:ENSORLG00000016037 transcript:ENSORLT00000020073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSAASVGNAEDYAADEAERTAADNIVFDDYRGKGCVDDSGFVYKLGERFFPGHSNCPCEC
TEDGPVCDQPECPKLHPKCTKVEHNGCCPECKEVKNFCEYRGKTHKILEEFKPSPCEWCR
CEPNNEVHCVVSDCAVPECVNPVYEPEQCCPICKNGPNCFAGTTIIPAGIDVKVDDCTIC
RCHNGDWWKPAQCLRRECLNGPSL
Download sequence
Identical sequences H2MMX6
ENSORLP00000020072 ENSORLP00000020072 8090.ENSORLP00000020072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]