SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000020243 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000020243
Domain Number 1 Region: 50-159
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 4.45e-38
Family Frizzled cysteine-rich domain 0.0000813
Further Details:      
 
Domain Number 2 Region: 176-303
Classification Level Classification E-value
Superfamily TIMP-like 1.35e-25
Family Netrin-like domain (NTR/C345C module) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000020243   Gene: ENSORLG00000016179   Transcript: ENSORLT00000020244
Sequence length 309
Comment pep:known chromosome:MEDAKA1:9:26538738:26552357:-1 gene:ENSORLG00000016179 transcript:ENSORLT00000020244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TENMGSASVLFRRWTQLVLLLAVTCGASEYEYTWAAGSYNGGRGYGKAPQCVDIPDDLRL
CHTVGYTQMLLPNLLEHETMAEVKQQASSWVPLVHKNCHKDTQVFLCALFAPVCMERPIY
PCRWLCETVRDGCSPIMEAFGFPWPEMLTCDKFPQDGVCIAVTQPNATEATWPSGHSPAC
PPCDNEIKNDAMLENICASEFALKAKIKEVKQENMDRKVILQRRKRMVKQGNLKKRDLKK
LTLYLKNGANCPCQQLENLENQYLIMGRKVDKQFLLTGIHKWDKSSKEFKKIMKKLKNYK
CPAFENVFK
Download sequence
Identical sequences H2MNE0
ENSORLP00000020243 8090.ENSORLP00000020243 ENSORLP00000020243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]