SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000020252 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000020252
Domain Number 1 Region: 95-233
Classification Level Classification E-value
Superfamily ISP domain 6.2e-39
Family Rieske iron-sulfur protein (ISP) 0.00000239
Further Details:      
 
Domain Number 2 Region: 40-108
Classification Level Classification E-value
Superfamily ISP transmembrane anchor 2.01e-24
Family ISP transmembrane anchor 0.0000567
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000020252   Gene: ENSORLG00000016185   Transcript: ENSORLT00000020253
Sequence length 235
Comment pep:known_by_projection chromosome:MEDAKA1:6:25833054:25834408:1 gene:ENSORLG00000016185 transcript:ENSORLT00000020253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSTLVRPGGFAPYLQVTKHGAKSLLFPGAAEPAWGTRLAHTDIKIPDFSDYRRPEVLDP
NKSSQESSEARRAFSYLLTGATTVVGVYAAKTVVTQFVSSMSASADVLALSQIEIKLGDI
PEGKNMTFKWRGKPLFVRHRTEKEIATEEAVNLTELRDPQHDKDRVINPKWVIVLGVCTH
LGCVPISNAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPFYEFPDEETVVVG
Download sequence
Identical sequences H2MNE9
ENSORLP00000020252 XP_004069909.1.28442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]