SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000020254 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000020254
Domain Number 1 Region: 134-272
Classification Level Classification E-value
Superfamily ISP domain 9.23e-39
Family Rieske iron-sulfur protein (ISP) 0.00000239
Further Details:      
 
Domain Number 2 Region: 79-147
Classification Level Classification E-value
Superfamily ISP transmembrane anchor 2.62e-24
Family ISP transmembrane anchor 0.0000567
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000020254   Gene: ENSORLG00000016185   Transcript: ENSORLT00000020255
Sequence length 274
Comment pep:known_by_projection chromosome:MEDAKA1:6:25833154:25834317:1 gene:ENSORLG00000016185 transcript:ENSORLT00000020255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSTLVRPGGFAPYLQVTKHGAKSLLFPGAAEPAWGEAEVNQVSRCRPAGAEPPCSGQEV
NLLLRCSLESSAPAGTRLAHTDIKIPDFSDYRRPEVLDPNKSSQESSEARRAFSYLLTGA
TTVVGVYAAKTVVTQFVSSMSASADVLALSQIEIKLGDIPEGKNMTFKWRGKPLFVRHRT
EKEIATEEAVNLTELRDPQHDKDRVINPKWVIVLGVCTHLGCVPISNAGDFGGYYCPCHG
SHYDASGRIRKGPAPLNLEVPFYEFPDEETVVVG
Download sequence
Identical sequences H2MNF1
ENSORLP00000020254 ENSORLP00000020254 8090.ENSORLP00000020254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]