SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000020363 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000020363
Domain Number 1 Region: 244-484
Classification Level Classification E-value
Superfamily Caspase-like 3.29e-44
Family Caspase catalytic domain 0.00018
Further Details:      
 
Domain Number 2 Region: 95-181
Classification Level Classification E-value
Superfamily DEATH domain 3.18e-19
Family DEATH effector domain, DED 0.0078
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000020363
Domain Number - Region: 10-77
Classification Level Classification E-value
Superfamily DEATH domain 0.000447
Family DEATH effector domain, DED 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000020363   Gene: ENSORLG00000016267   Transcript: ENSORLT00000020364
Sequence length 484
Comment pep:known_by_projection chromosome:MEDAKA1:21:21848351:21852847:-1 gene:ENSORLG00000016267 transcript:ENSORLT00000020364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDHQRNHLYYINKIVEALSSSECRKLLFLCDSTSADSSVQSVRETLKLQVTCHDNASQFL
AEVIWRMGRYDILKELFTLSRNAVEQTLENRQVLSKFRVLMANISEDLDTEDLEQILFLL
STTLPREKRDAKQSFLDVIVELEKLDLVSPERVDMVEECLRNICRIDLAKKVSTYKKTVF
RQNQKKSIISAERQAFIRKLTSECGRDVVLSQTSARMENKDLLLIHNDLNKEILSNSTFF
NGAFQLQHSQLEQYSLNSKPRGLCVIIDCVGFDQGMLEQTFKALHFNVVLHPLLGGKQII
SCLTEILKQEQNLKGDAFVCCIISRGTANHLLGIDSYGMGVSLDHVRQSFTGNACPMLAG
KPKLFFIQTYSLDEGGSCDRIEHRDGDIEIDGCNGPLTSSYIPSEADMFWSHCLTDVSQL
DQGGHHSVYLRTLTAALENARIRKADLVDAHTKVNGAVYEHNSRNPTSVYHISVKHTLRK
SLYL
Download sequence
Identical sequences H2MNQ7
ENSORLP00000020363 ENSORLP00000020363 8090.ENSORLP00000020363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]