SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000020373 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000020373
Domain Number 1 Region: 808-885
Classification Level Classification E-value
Superfamily DEATH domain 2.08e-16
Family DEATH domain, DD 0.00012
Further Details:      
 
Domain Number 2 Region: 208-259
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 7.32e-16
Family TSP-1 type 1 repeat 0.00047
Further Details:      
 
Domain Number 3 Region: 118-208
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000477
Family I set domains 0.027
Further Details:      
 
Domain Number 4 Region: 262-316
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000366
Family TSP-1 type 1 repeat 0.00065
Further Details:      
 
Domain Number 5 Region: 11-113
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000311
Family I set domains 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000020373   Gene: ENSORLG00000016270   Transcript: ENSORLT00000020374
Sequence length 910
Comment pep:known_by_projection chromosome:MEDAKA1:9:26713222:26831890:-1 gene:ENSORLG00000016270 transcript:ENSORLT00000020374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSLPSGHGTLPHFIQEPEDAYIVKSNPTKLRCRATPALQIFFKCNGEWVHQNEHMSHEYK
DLITGLKVREVMINISRQQVEDFHGPEDYWCLCVAWSHLGTSKSRKATVRIAYLRKNFEQ
DPQGKEVPINRMIVLHCRPPEGVPAVEVEWLKNEELVSSMTDDNIDSRADQNLIINEARL
SDSGNYTCLASNIVAKRRSATATVIVFVNGGWSLWTEWSPCNVPCGWGVQKRSRTCTNPA
PLNGGAFCEGMSVQKIPCNALCPVDGGWDEWSEWTLCNSLCGRHRTRECSSPAPRHRGKM
CEGNSEATENCTDGLCTQNRNLRHDVKPQSWCLLSMEGSNDVALYLCLGAGIIAVAFLVV
VVMLYRKSHSEYGVDVIDSSALTRGCQSFNFKTTSQGNPLLLNSSMRSDLTVGRTYSTPI
CFHESADKELFDPLPDIAVKVQSSFMISLGVADHATFPDKVPAETYQRDLGCEYCSTMER
RKKDTLMFSRPIAVDKEQPRTSGVFGHQGGRLAVPSTGVSLLVPHGAVAEYMSCEVYMVI
NQGESSIETLEGCEILLGPEVTYGPSNLDLFCPAAVTVPHCAVVDKENWNIQLRRKTQDS
KWEEVMLVDEESTSCFCLMDSTCCHLLLDQPGSYALVGEPLNQAAMKRLKLGVFGGLEAS
STNYCLRVYCVDDTPHGFQRVVAAERTRGGQLLEEPKMLPFQANTFNLQVSIQDVPQFLW
SIKPFTTCQEFSFSQVWCSNQQPMHCTFALERFSPATAQLSCKISVRQVKGHEQILQVYT
AVAEGEKESPPFFMQTDCSVTSQTGPKAFKIPSSIRERICATFDTANAKGKDWQLLAQKL
HLDRNLGYFAKQHSPSAVILSLWEVCHPDADDLDSLANALEEIGKIHSCSSPEDQDEDQS
DAGHVDASSL
Download sequence
Identical sequences H2MNR7
8090.ENSORLP00000020373 ENSORLP00000020373 ENSORLP00000020373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]