SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000020440 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000020440
Domain Number - Region: 4-30
Classification Level Classification E-value
Superfamily FnI-like domain 0.0356
Family Fibronectin type I module 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000020440   Gene: ENSORLG00000016328   Transcript: ENSORLT00000020441
Sequence length 63
Comment pep:known chromosome:MEDAKA1:9:27042548:27224436:-1 gene:ENSORLG00000016328 transcript:ENSORLT00000020441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPSVCETWVRFRAAPYSLLCCCAGPKPGCFEKVAAGRASGVKHCQIYHATCSLWRPLMGK
SRK
Download sequence
Identical sequences H2MNY2
ENSORLP00000020440 ENSORLP00000020440 8090.ENSORLP00000020440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]