SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000020455 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000020455
Domain Number 1 Region: 29-104
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000251
Family Growth factor receptor domain 0.0037
Further Details:      
 
Domain Number 2 Region: 91-163
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000105
Family VWC domain 0.038
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000020455
Domain Number - Region: 225-267
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00034
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000020455   Gene: ENSORLG00000016338   Transcript: ENSORLT00000020456
Sequence length 362
Comment pep:known_by_projection chromosome:MEDAKA1:7:25754141:25765014:-1 gene:ENSORLG00000016338 transcript:ENSORLT00000020456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFCSMPQALIDNCLSVFLRILLWLCDRSCFCPAPAPECPAGVPLVLDGCGCCKVCARQQ
GEPCTGMLPCDGQKGLQCDYSASLPGDPGECVAKKDDLSCEVNGVSYQDGQSFKPSCDTY
CHCRGGGVVCVPACPLNTRLPTPDCPNPQHVRLPGKCCKEWVCENLENTVIQDAINASSA
FQVTQGCCTRRLSNKLGRKLKWGCQMLWLPTATNKTEKIKNLSCVEQSTRWSACSRSCGA
GVSTRVSNQNSACKLQMESRLCKVRPCNDVRSAPWGQQGRCKASYKSPGPIRLVHQGCYS
ARTYRLRYCGQCSNSRCCTPHQTSTAQVTFRCRTGRPLQRAVMMIHSCVCHENCPSTRFT
NP
Download sequence
Identical sequences H2MNZ7
ENSORLP00000020455 8090.ENSORLP00000020455 ENSORLP00000020455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]