SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000020457 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000020457
Domain Number 1 Region: 22-101
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000251
Family Growth factor receptor domain 0.0037
Further Details:      
 
Domain Number 2 Region: 90-163
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000487
Family VWC domain 0.038
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000020457
Domain Number - Region: 200-246
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00017
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000020457   Gene: ENSORLG00000016338   Transcript: ENSORLT00000020458
Sequence length 338
Comment pep:known_by_projection chromosome:MEDAKA1:7:25754162:25765358:-1 gene:ENSORLG00000016338 transcript:ENSORLT00000020458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRLLCDCVTAVAVLLCVATQVFCQLCDRSCFCPAPAPECPAGVPLVLDGCGCCKVCARQ
QGEPCTGMLPCDGQKGLQCDYSASLPGDPGECVGQDDLSCEVNGVSYQDGQSFKPSCDTY
CHCRGGGVVCVPACPLNTRLPTPDCPNPQHVRLPGKCCKEWVCENLENTVIQDAINAMRT
DRLWPSLPRNRPLNQLSPPGPSCVEQSTRWSACSRSCGAGVSTRVSNQNSACKLQMESRL
CKVRPCNDVRSAPGKPLWGQQGRCKASYKSPGPIRLVHQGCYSARTYRLRYCGQCSNSRC
CTPHQTSTAQVTFRCRTGRPLQRAVMMIHSCVCHENCP
Download sequence
Identical sequences H2MNZ9
ENSORLP00000020457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]