SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000020763 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000020763
Domain Number 1 Region: 1222-1279
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000114
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 129-185
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000209
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 3 Region: 566-630
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000157
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Domain Number 4 Region: 973-1030
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000183
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 5 Region: 295-352
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000523
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 6 Region: 1277-1327
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000249
Family TSP-1 type 1 repeat 0.0058
Further Details:      
 
Domain Number 7 Region: 711-765
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000314
Family TSP-1 type 1 repeat 0.0062
Further Details:      
 
Domain Number 8 Region: 1105-1153
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000772
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 9 Region: 1157-1218
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000615
Family TSP-1 type 1 repeat 0.0057
Further Details:      
 
Domain Number 10 Region: 447-509
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000772
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000020763
Domain Number - Region: 843-898
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000107
Family TSP-1 type 1 repeat 0.0068
Further Details:      
 
Domain Number - Region: 632-706
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000129
Family TSP-1 type 1 repeat 0.0077
Further Details:      
 
Domain Number - Region: 1349-1413
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000235
Family TSP-1 type 1 repeat 0.0052
Further Details:      
 
Domain Number - Region: 359-434
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000432
Family TSP-1 type 1 repeat 0.0081
Further Details:      
 
Domain Number - Region: 1029-1087
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0103
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Domain Number - Region: 772-842
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0327
Family TSP-1 type 1 repeat 0.01
Further Details:      
 
Domain Number - Region: 56-127
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0484
Family TSP-1 type 1 repeat 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000020763   Gene: ENSORLG00000016584   Transcript: ENSORLT00000020764
Sequence length 1596
Comment pep:known_by_projection chromosome:MEDAKA1:16:28373817:28478877:-1 gene:ENSORLG00000016584 transcript:ENSORLT00000020764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPWGRCMGSDCGPGGSQSRAVWCAHVDGWTTLHTNCDQNLRPSNQRNCFRVCDWHKDLYD
WKLGAWNACVPVSSRTFGAARQLPCSGGEEGIQTREVGCILKADGLPADDAICEYFEPKP
RLEQACLIPCPQDCVVSEYSPWTSCSKTCGTGLRNRVRSVLVPPLFGGGLCPNLTEFLSC
KPGPCKGPEGLYSLRVGPWSPCALPGSRTARQAKRRKGKGQGLRERGGVKDPETRELIQK
KRTRNRLNRQDSPFWDIQVGYQTREVTCIHRNGSTVARNLCGPRDQPLIIQSCILPKDCR
VTEWAEWSSCSKTCVDPESPRGNRTRRRQVLQFSVGEEAPCPPLEETQPCEPQGGGVPPC
TTYTWRTTEWTDCRVDLLLSQQDRRRGNLTGLCGGGLQTREVYCVQANAEVLKYLNDLRE
KEKASPPVENRLCQGPIPNRSQLCQIPCPVDCEVSPWGAWGPCTFENCDDQTGKKGFKLR
RRRISNEPTGGPGSCPHLVEAVPCDEPACYGWQLASLDECLPADGQQCGSGARQPQVRCI
NSSGELVDRTLCSAFPPPASVACDVPCSRDCVLSDWTSWSSCSQTCSSKTIEGKQMRTRS
ILAYNAGEGGALCPNSSALQEVRNCNEHACTVYHWQTGPWGPCTEDPSSPSFNASAVVRS
SSSSQGPCSLGMQTRKVICVRVNVGQVPPKKCPDGPRPTTMRPCQLPCKKDCIVTPFSDW
TECPLICDAAGNAVKKKQSRKRLIIQMPSNGGQECPEVLEEERDCEAPRSCPGFRWKTHK
WRKCQLVPWSLRKENPGAQENCGSGLQTRAMSCRQLDGTQGDISECLKFAKVMPPITQRC
QLPCQDDCQLTNWSKFSSCTADCVGVRSRKRALIGRSKKKDKCKNTQMYPLSETQYCPCD
KYNAQPVGRWSDCILPDGARAESPLGLKVQGDVKECGQGYRYQAMACYDQDSRLVETSRC
NSHGYIEEACIIPCPSDCKLSEWSNWSRCSKSCGSGVKVRSKWLREKPYNGGRPCPKLDH
INQVYEVVPCQSDCNQYVWVAEPWSVWKVSNVDLKENCGEGVQTRKVRCMLNTVDGPSEG
VEDYLCDPEEMPLGARESRLPCPEDCVLNDWGPWSRCSLPCTRTNSRVRTAYVIRSPSAG
RECPDTTDKEACSLNLNCFNYFYNITDWSTCQLSPNAVCGRGIKTRMLDCVRSDGKSVDM
KFCEELNLERKWQMNASCVVECPVNCQMSEWSPWSDCSQTCGLEGKMRRQRLVVQASQGD
GRPCPSQVEQWKPCPVRPCFRWQYGAWSECRVESVVCGEGVRYRNLSCFVSDGSADGDFI
MVDEELCSDLELAVNGDEQIHLKEPCTLPCPGECYLMEWSDWSSCVNICVKEAGVDFGSV
QVRSRAVLAQEPENLQLCPDQVWESKPCTGGECYQYKWFGSADSPGAWCQRSDGLNVTGG
CTAASPPVDNSSCDPPCLMPKSFCSEAGVCMCEEGFTEVLSPTGQLRECAPIPVLEIPTA
GDKKGDVKTSRAVNPTLPSTLQPGRSGRTWYLQPYGPXSQLHRWIHVLQGGGFALLAVLH
HLVRIKNKKPKRPQRQRQQNNRLKPLTLAYDGDTDM
Download sequence
Identical sequences H2MPV0
8090.ENSORLP00000020763 ENSORLP00000020763 ENSORLP00000020763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]