SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000020803 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000020803
Domain Number 1 Region: 489-615
Classification Level Classification E-value
Superfamily TIMP-like 3.92e-24
Family Tissue inhibitor of metalloproteinases, TIMP 0.059
Further Details:      
 
Domain Number 2 Region: 243-314
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000184
Family Laminin-type module 0.051
Further Details:      
 
Domain Number 3 Region: 312-376
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000012
Family Laminin-type module 0.026
Further Details:      
 
Domain Number 4 Region: 374-430
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000614
Family Laminin-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000020803
Domain Number - Region: 79-144
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00187
Family Galactose-binding domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000020803   Gene: ENSORLG00000016622   Transcript: ENSORLT00000020804
Sequence length 616
Comment pep:known_by_projection chromosome:MEDAKA1:23:20789297:20813007:1 gene:ENSORLG00000016622 transcript:ENSORLT00000020804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVAPRCENRACNPRMGNLALGRQVLTQTVCGNNGTELYCSYSDPNSNLACSAPKCSKCNA
GLPHLSHLAGSMSDSSFRHPNTWWQSAEGVESETVQLDLETTFYFTHLIIVFRSTRPAVM
TLERSQDFGRTWEALQYYASNCTTSFGLLESKGVQDRPACTSKYSGAFPCNRGEVIYRAL
PKWKSMDPFGMEGQQQLRVTNIRIQLLKHQPCPCQAKVLASSNRKPLPTRHFAIYDLIVK
GSCFCNGHAEQCVPAPGYKPVRDRTNHVVHGKCVCRHNTAGEHCERCAPLYNDRPWQPAD
GLTGAPHECRKCKCNGHAQSCRFDWTAWRESGQRSGGICDCLHNTEGRQCQKCKAGFHRD
PRRPQTAPDSCKPCSCHPMGSILYNSTDGSTCDPSNGNCICKPGVGGERCDRCMVGYWGF
HEYGCRPCDCAGDCDPFTGDCMFGQMDITHTYDILNFRPDLDPNNLEGNSSEASRIFRTD
ELFSAFHYSEKCECKEQVLTNSKLFCTMNYAYVLKVRVLTAHDKGTHAEVEVKVQKVLSP
SSKMKIQRGRVTLYPKSWTARGCTCPILNPGVEYLVAGYLDRKQGHLLVNMKSFVKPWKA
SLGRKVLTMLKKDCNW
Download sequence
Identical sequences H2MPZ0
ENSORLP00000020803 8090.ENSORLP00000020803 ENSORLP00000020803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]