SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000020868 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000020868
Domain Number 1 Region: 62-528
Classification Level Classification E-value
Superfamily Sema domain 9.42e-128
Family Sema domain 0.0000197
Further Details:      
 
Domain Number 2 Region: 1371-1497,1692-1879
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.47e-52
Family p120GAP domain-like 0.02
Further Details:      
 
Domain Number 3 Region: 974-1062
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000535
Family Other IPT/TIG domains 0.047
Further Details:      
 
Domain Number 4 Region: 1061-1164
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000611
Family E-set domains of sugar-utilizing enzymes 0.044
Further Details:      
 
Domain Number 5 Region: 531-582
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000111
Family Plexin repeat 0.0019
Further Details:      
 
Domain Number 6 Region: 876-959
Classification Level Classification E-value
Superfamily E set domains 0.000000000007
Family Other IPT/TIG domains 0.012
Further Details:      
 
Domain Number 7 Region: 1162-1252
Classification Level Classification E-value
Superfamily E set domains 0.0000000658
Family E-set domains of sugar-utilizing enzymes 0.056
Further Details:      
 
Domain Number 8 Region: 829-862
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000131
Family Plexin repeat 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000020868
Domain Number - Region: 676-719
Classification Level Classification E-value
Superfamily Plexin repeat 0.085
Family Plexin repeat 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000020868   Gene: ENSORLG00000016679   Transcript: ENSORLT00000020869
Sequence length 1911
Comment pep:known_by_projection chromosome:MEDAKA1:5:31085286:31234066:1 gene:ENSORLG00000016679 transcript:ENSORLT00000020869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKAHRELILELRALPLDSSDMFPSVRSAAFPGQRNLLLLLGLLLIVCSSISGGKPPAFKR
FAPANCLLTHLVIHNKTGEVYVGAVNRIFKLSSNLTELRSHMTGPVVDDEKCYPPPSVQS
CPYQLSQTPNVNKLLLIDYSQNRLIACGSTSQGICQFLRLNDLFKLGEPHHRKEHYLSSV
AESGTMSGVIISSPQNPVSKLFIGTPVDGKSEYFPTLSSRKLMENEENADMFSFVYQDEF
VSSQLKIPSDTLSKFPTFDIYYIYSFSSEQFVYYLTLQLDTQLSSPDATGEQFFTSKIVR
LCVDDPKFYSYVEFPIGCTKGGTEYRLVQDAFLARPGRQLANSLGISENEDILFTIFSQG
QKNRAKPPKESALCLFTLKKIKQKIKERIQSCYRGGGKLSLPWLLNKELICINSPLQIDD
DFCGQDFNQPLGGTSPIEGVPLYIDKEDGMTSVAAYDYRGNTVAFVGTRNGKLKKILVNS
VNSNRSAVLYEKVTVSEGGSPLLRDMLFSPDLQHIYTLTDRQVVRVPVESCEQYTTCGEC
LGSRDPHCGWCVLHNVCSRKDRCERAGEPQRFASDQRQCVELTVQPGNISVTMSEVQLVL
QARNVPDLSEGVNCSFEDYVETEGRIQGEHIFCLSPSATDIAPITKNKGDKRVIKLYLKS
KETDKKFASVDFVFYNCSVHQSCLSCVNGSFPCHWCKFRHICTQNAYDCSFMEGLIKNSE
GCPQILPSTQIYIPVGVTKPIHLAAKNLPQPQSGQRNYECVFHIQGETHSVPAVRFNSTS
IQCQKTAYNYEGDDISDLPVDLSVMWNGKFVIDNPLNIKAHLYKCDALRKSCGMCLKANP
RFECGWCAAEKKCSLRQECTPPETTWMHATTGNTRCIHPKITKLTPDLGPRQGGTMLTIL
GENLGLQFKDIQNGVRIGKVICIPQEEEYISAERIVCQLNDATGYRVQHAQVEVCVRDCL
HPDYKTVSAKPFTFVTPFFTHVHPNVGPQSGGTRITIEGSDLNAGSNVTVNIGLYPCRFE
KRNSKEIVCVTSAAKATGAMPVMVDINSAELRNPEVKFNYTSDPTILKIDPDWSIASGGT
TLTVTGTDFATIKEPRMRAKYGAALSVNNCTVLNNTVMVCLVPSVAGSDQLLPDAVISPD
EIGFVMDDVHSVLVVNETFSYHPDPVLEPLSPTGKLVLKPTSPLILKGRNLIPVVTGNYK
LNYTVLIGDTPCVLTLSESQLLCEWPNLTGEHKVTVRVGGFEYSPGTLQIYSDSLLTLPA
IIGIGGGGGLLLLVIIMVLIAYKRKSRDADRTLKRLQLQMDNLESRVALECKEAFAELQT
DIHELTQELDGAGIPFLDYRTYAMRVLFPGIEDHPVLKEMEVPANVEKSLTLFGQLLTKK
HFLLTFIRTLEAQRSFSMRDRGNVASLIMTALQGEMEYATGVLKQLLSDLIDKNLESKNH
PKLLLRRTESVAEKMLTNWFTFLLYKFLKECAGEPLFMLYCAIKQQMEKGPIDAMTGEAR
YSLSEDKLIRQQIDYKTLTLHCVNPENENAPEVTVKSLNCDTVTQVKEKLLDAVYKGTPY
SQRPKASDMDLEWRQGRMARIILQDEDVTTKIDNDWKRLNTLAHYQVMDGSVIALVPKQN
SAYNISNSSTLTKSLSRYESMLRTASSPDSLRSRTPMLTPDLESGTKLWHLVKNHDHSDQ
REVDRGSKMVSEIYLTRLLSTKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQ
ADKHFITDSDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKNSITDACLSVVAQTFMDSCS
TSEHKLGKDSPSNKLLYAKDIPNYKNWVERYYSDISRMSAISDQDMSAYLAEQSRLHANQ
FNSMSALHEIYSYIIKYKDEILSALERDEQARRQRLRSKLEQVIDTMALSS
Download sequence
Identical sequences H2MQ54
ENSORLP00000020868 8090.ENSORLP00000020868 ENSORLP00000020868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]