SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000020908 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000020908
Domain Number 1 Region: 156-227
Classification Level Classification E-value
Superfamily Homeodomain-like 1.75e-19
Family Homeodomain 0.0027
Further Details:      
 
Domain Number 2 Region: 40-104
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000017
Family LIM domain 0.016
Further Details:      
 
Domain Number 3 Region: 9-39
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000464
Family LIM domain 0.009
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000020908
Domain Number - Region: 100-127
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0514
Family LIM domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000020908   Gene: ENSORLG00000016714   Transcript: ENSORLT00000020909
Sequence length 355
Comment pep:known_by_projection chromosome:MEDAKA1:4:31744000:31752501:1 gene:ENSORLG00000016714 transcript:ENSORLT00000020909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TFSIHADAHHWVVCVGCQRRITDRFLLRVADGLWHERCVRCAACGDALRNSCFLLERKLY
CKRDYSSLFAVHCGGCAEAISPSELVMRAGAAVFHLSCFTCSVCFHHLKTGDRCILQDGR
LLCAREDYHQLQASPPSSDIGKSGDDEEEEPSAKVMDKPGRSHDQENKRPKRPRTILTTQ
QRRTFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKLARRQQQDQQQTT
QECCERPSHHTAPSCGSLTSEIKRVECSFTPQLQQMVLTTLEQQDWDADPFRQGLTPPQM
PGDHMHPYGLKVLYGDMDREPLCCASDSECLSLGDSSPLTPIDRLYSMQDSYFTS
Download sequence
Identical sequences H2MQ92
ENSORLP00000020908 8090.ENSORLP00000020908 ENSORLP00000020908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]