SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000020936 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000020936
Domain Number 1 Region: 154-232
Classification Level Classification E-value
Superfamily Homeodomain-like 1.07e-23
Family Homeodomain 0.0000926
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000020936   Gene: ENSORLG00000016741   Transcript: ENSORLT00000020937
Sequence length 296
Comment pep:known_by_projection chromosome:MEDAKA1:5:31432978:31434536:-1 gene:ENSORLG00000016741 transcript:ENSORLT00000020937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGDPSFKSESPVRFTDTGRTCMAPSTAMSALTAALKTEDLSPRAAVVNMQTSLEDSGKPK
VAILPFSVEALMADRKPSREASSPDSAAGTSQALGKGARIASFGGLDTSGSALPTSSPFS
VGEIMNMSEDVMIKAESPDSKERTSWIQSPRFSPTSPRRLSPPACPLRKHKTNRKPRTPF
TTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRLQEAELEKLK
MAAKPMLPPAFGISFPLGAHVPASYAGSHPFQRHSLPVSPVGLYAAHVGYSMYHLA
Download sequence
Identical sequences H2MQB9
8090.ENSORLP00000020936 ENSORLP00000020936 ENSORLP00000020936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]