SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000020940 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000020940
Domain Number 1 Region: 1194-1416
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.06e-64
Family DBL homology domain (DH-domain) 0.000000054
Further Details:      
 
Domain Number 2 Region: 1416-1556
Classification Level Classification E-value
Superfamily PH domain-like 8.84e-31
Family Pleckstrin-homology domain (PH domain) 0.00000175
Further Details:      
 
Domain Number 3 Region: 200-301
Classification Level Classification E-value
Superfamily EF-hand 1.73e-28
Family Eps15 homology domain (EH domain) 0.0024
Further Details:      
 
Domain Number 4 Region: 1569-1667
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.74e-25
Family PLC-like (P variant) 0.0076
Further Details:      
 
Domain Number 5 Region: 1115-1196
Classification Level Classification E-value
Superfamily SH3-domain 5.64e-24
Family SH3-domain 0.0000509
Further Details:      
 
Domain Number 6 Region: 5-97
Classification Level Classification E-value
Superfamily EF-hand 4.17e-23
Family Eps15 homology domain (EH domain) 0.0011
Further Details:      
 
Domain Number 7 Region: 981-1052
Classification Level Classification E-value
Superfamily SH3-domain 2.63e-20
Family SH3-domain 0.00018
Further Details:      
 
Domain Number 8 Region: 721-788
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000827
Family SH3-domain 0.00048
Further Details:      
 
Domain Number 9 Region: 1048-1122
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000263
Family SH3-domain 0.00015
Further Details:      
 
Domain Number 10 Region: 919-951
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000289
Family SH3-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000020940   Gene: ENSORLG00000016740   Transcript: ENSORLT00000020941
Sequence length 1696
Comment pep:known_by_projection chromosome:MEDAKA1:24:14692349:14717036:1 gene:ENSORLG00000016740 transcript:ENSORLT00000020941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEASVWAITPEERGKHDKQFDSLSPILGYVSGEQARKFFLQSGLPASVLAEIWNLSDLDS
DGKMDRLEFSIAMKLIKHRLQGWNLPSSLPTIMKQPPNSNSSGPVPSARFAITGFLHLPV
CFFCVGMGSMPNLSLSLSSMSTMPIMPSLTPIPANPPLPSMVPLVPMQMTLPLNSSFGNS
GLSNGNTVKLLKVQSFGTSPKMGAGDWAVPQASRLKYRQQFNTLDKLMSGYLSGPQVRNA
LMASNLTQTQLATIWYLADVDKDGQLRADEFILAMHLVDMAKTGYPLPLTLPQDLVPPSL
RLAHGGAGVTVQAGVCYRRRTQFLPISSNLAQPLKRSRPTVHKLQPDQLYDFRGGIKLVE
LVNGTGPCTTPSLIDTAETEPSQKGKSNVSYEDKLKENFARGSAELEKRRLALEEEQMRE
LERKEASKQEMERQRREEYERRMKEELAHRKEGEREQISRLRAKKRSLELELEAVGKKHK
QISDRLRDAQSKRRIQKAEVDLVNQKRDGRIAEINTLQLEFETWQRKLSELVPEQQRLTE
KLRKMSLNKLSPLTLTSLTGNVTEKSVNCRRLKDQLDTLEKETTDKLTQMEQYSKELKMH
QELREKQVKQQAVLDDLYRVKEEKLKELQRHRPGSQFRGNSPARTWKHRRVGKDCKHTRK
LFFTLTLRHNQLYKLKDQWERFKNRSKDDWTRLRAAQEKAQEEEQKELEVMKKKELERGG
QLTTYKALYSFVARNADELSIDANCLIQLWQVNELTVGEPGWLCGTYCGKRGWFPQSYAE
KCPTFLTSEAAAPAAGKKSCLQPNTKDPAVEKADNNTALVNSDPSQTRSHGLSVFSLCPI
NKGKHPEGGSSWPYTVSGSRCVRPAAGATNVHAHLLPQHAYSTRPSFVLVGLSSVKCLLA
RAISSWSATSGGHPDSPPEDDIITVLQQRDEWWLGQLNGTQGWFPRSYVTLEMDGSACVA
AMTGRMELTHPTPLSWKSDLCPSEPEYVALYTYESPEAGDLTFAEGDVVMVTDREGEWWR
GCIGDKTGVFPSNYVRPIEPEASRLGASAKKPEIAQSVVTAEAPAPHQLLLSPGQLIVIC
AKNSTGWWLGELQARGKKPQRGWFHSSHVKLLGPSSTKSSPSPLPALTCNHSVCQVIAMY
DYTAANQDELSFSKGQLINILDKTNPDWWKGEVNGVTGLLPTNYIKMTTESDPSQQWCAD
LMTLDTMTPQERKRQGYIHELIQTEETYVEDLELVLEVFHKPMSESGRLTEAEMATIFVN
WRKLIMCNHKFLKALRARKKTGGENMPIQLIGDVLASELAQMHPYICFCSGQLNAAALLQ
SKTNNQPDFKDFLRKIATNYRCKGMPLSSFLLKPMQRITRYPLLIKNILENTPESHADHG
PLREALERAEELCFQVNEGVREKENSDRLEWMQSHIQCEGPIENLVFNSLTNCLGPRKLL
HSGRLYKTKGTRELWAFLFNDFLLLTHSTKHFSFSGSDKLFSPKTSAQLKMYKTPLFLNE
VLVKMPPDPSSDEPVFHVSHIDRVYTLKTETLSERATWVQKIKAASEHFIETEKKKREKA
YQARSLKTSGIGRLLVTIIEAQELKACKPNGKSNPYCELTMGAQCYTSRPASDTPNPKWN
FSCQFFINDLYQDVLCITVFEKDQFSPDDFLGRTEVPVATIKKDMETKGAANRRLLLHEV
PTGEVWVKLDLQLYEP
Download sequence
Identical sequences H2MQC3
8090.ENSORLP00000020940 ENSORLP00000020940 ENSORLP00000020940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]