SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000021015 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000021015
Domain Number 1 Region: 290-374
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000083
Family I set domains 0.028
Further Details:      
 
Domain Number 2 Region: 43-131
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000276
Family V set domains (antibody variable domain-like) 0.093
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000021015
Domain Number - Region: 178-209
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0196
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000021015   Gene: ENSORLG00000016797   Transcript: ENSORLT00000021016
Sequence length 413
Comment pep:known_by_projection chromosome:MEDAKA1:7:27407057:27413681:1 gene:ENSORLG00000016797 transcript:ENSORLT00000021016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWMLVVPILLFLPYGVWTYEAPEDKQDVFAVKACPAFLTFVNVAYLAGATVELLCHCKP
PEVQYVVWFFRKHRASSTETRALTDHHGNRLQDTSEVLHSSDLRSRFSIRLFSLLVFRAG
PLDSGVYICGSAHRDFFFGFDLDIQEVHTLTFTPRLSLQNLKKKSQEETANSHPLYKVFT
SFQPWSQCDRCGVEGEQVRIGLCFVHSHILHVRYRWTNQSVASCGSEAVPRAFTQLKQRK
VGPKMEVKSCQVACPTEAPPPSKVMAFTAFLGYSSASQVAQIKVFHLNHPADTVLTLGCP
GAHSDMAVAWDQESTPIYRFHHPSAGNIRATSARLLIDTGHHLVFQPAKTQDSGVYHCWL
QGRRVAEIHLLVYAHLGRGKSVLSDPELPAAAEFVLKSYAVMTALFLLLLFCR
Download sequence
Identical sequences H2MQJ6
ENSORLP00000021015 8090.ENSORLP00000021015 ENSORLP00000021015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]