SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000021090 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000021090
Domain Number 1 Region: 690-905
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.69e-99
Family Thrombospondin C-terminal domain 0.0000000912
Further Details:      
 
Domain Number 2 Region: 567-688
Classification Level Classification E-value
Superfamily TSP type-3 repeat 3.66e-35
Family TSP type-3 repeat 0.00000436
Further Details:      
 
Domain Number 3 Region: 485-569
Classification Level Classification E-value
Superfamily TSP type-3 repeat 8.63e-18
Family TSP type-3 repeat 0.000073
Further Details:      
 
Domain Number 4 Region: 197-242
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 0.00000000000000745
Family Assembly domain of cartilage oligomeric matrix protein 0.0021
Further Details:      
 
Domain Number 5 Region: 402-510
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000497
Family TSP type-3 repeat 0.00019
Further Details:      
 
Domain Number 6 Region: 16-133
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000138
Family Laminin G-like module 0.0082
Further Details:      
 
Domain Number 7 Region: 281-320
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000258
Family EGF-type module 0.013
Further Details:      
 
Domain Number 8 Region: 334-377
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000335
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000021090
Domain Number - Region: 249-293
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0352
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000021090   Gene: ENSORLG00000016858   Transcript: ENSORLT00000021091
Sequence length 922
Comment pep:known_by_projection chromosome:MEDAKA1:16:29386073:29395369:-1 gene:ENSORLG00000016858 transcript:ENSORLT00000021091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VIDVLSLQDAKQSSVAVKKLSDGLSELSDVYVVSTFRLPPKSSGVLMGLYSKQDSRKYLE
VAVMGKINKVVVRYAKADGKIQMANLQNANLADGRAHAIILRLGGLRRSRMQLELYADCR
LVDSSQDLPPLPPLPEEAETVEVRHGQKTYSRLQGSLESLQLALGGSVVKAGALTDCPFQ
DSSAYNSARGEVSSILGDHTKALIGQLIIFNQILGELRQDIREQVKEMALIRNTILECQV
CGFHEPRPRCSPNPCFSGVSCMDSLQYPGYVCGPCPPGTTGNGTHCSDIDECELQPCFSP
EACVNTMGGFSCHPCPPGLWGPPLAGTGLDYAKAHRQECVDVDECVDLPDACVSNSICIN
SLGSYRCGGCKPGFFGNQTTGCLPRLSCAALAFDPCDTNAQCTMQRNGEVSCRCNVGWAG
NGHTCGEDTDIDGYPDRPLPCMDNNKHCRKDNCVFTPNSGQEDADNDGIGDQCDEDADGD
GIKNVEDNCRLVSNKDQQNSDSDSFGDACDNCPTDPNSDQTDTDNNGQGDACDQDIDGDG
IPNILDNCPKVPNPLQTDRDRDAVGDACDSCPEISNPTQTDIDNDLVGDLCDTNQDRDGD
GHQDSRDNCPDIPNSSQLDSDNDGLGDDCDDDDDNDNIHDDTDNCRLIPNPNQKDSDGNG
VGDVCENDFDNDAVMDMVDACPESAEVTLTDFRAFQTVILDPEGDTQIDPQWVVLNQGKE
IIQTMNSDPGLAIGYTAFNGVDFEGTFHVNTVTDDDYAGFIFGYQDSSSFYVVMWKQVEQ
LYWQSVPFKAKAEATLQLKAVKSQTGPGGYLRNALWHTGDTPGEVTLLWKDPRNTGWKDQ
TSYRWQLSHRPQVGYIRVKLFEGKTMVADSGVVIDTSMRGGRLGVFCFSQENIIWSNLRY
RCNDTVPEDFKTHRQQVMTHIQ
Download sequence
Identical sequences H2MQR7
ENSORLP00000021090 ENSORLP00000021090 8090.ENSORLP00000021090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]