SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000021092 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000021092
Domain Number 1 Region: 960-1173
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.41e-105
Family Thrombospondin C-terminal domain 0.00000000334
Further Details:      
 
Domain Number 2 Region: 31-234
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.29e-37
Family Laminin G-like module 0.000000486
Further Details:      
 
Domain Number 3 Region: 837-958
Classification Level Classification E-value
Superfamily TSP type-3 repeat 4.45e-35
Family TSP type-3 repeat 0.000000396
Further Details:      
 
Domain Number 4 Region: 494-551
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 1.7e-16
Family TSP-1 type 1 repeat 0.0000391
Further Details:      
 
Domain Number 5 Region: 696-780
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000000012
Family TSP type-3 repeat 0.00012
Further Details:      
 
Domain Number 6 Region: 440-489
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000379
Family TSP-1 type 1 repeat 0.0000859
Further Details:      
 
Domain Number 7 Region: 320-377
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000555
Family VWC domain 0.0031
Further Details:      
 
Domain Number 8 Region: 769-839
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000000196
Family TSP type-3 repeat 0.00033
Further Details:      
 
Domain Number 9 Region: 384-433
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000458
Family TSP-1 type 1 repeat 0.00088
Further Details:      
 
Domain Number 10 Region: 552-605
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000272
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000021092   Gene: ENSORLG00000016859   Transcript: ENSORLT00000021093
Sequence length 1175
Comment pep:known_by_projection chromosome:MEDAKA1:22:13716326:13722921:-1 gene:ENSORLG00000016859 transcript:ENSORLT00000021093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YLEMMLCGIFLLFMLWSSDGARLAESRDDNSVYDLFELARINKRNHGVSLVKGADPYSPA
YKILNADLIPQVPDGSFRDLLDSIQAERGFLLLLNLKQYKRSRGTMLSIEKTDGSGPVFE
IISNGKANTLDVVYATENQQQVVSIEDADLATGHWKNITLFVQEDRAQLYVGCEEINVSE
MDAPIQTVLSREVADIARLRIGKGSARDKFMGVLQNVHFVFGTSLDAILRNKGCQSGATL
TDVMRLDNPVNGSSPAIRTDYTGHKSKDLQTVCGFSCEDITSMFKELRGLNVIVKQLSNE
LEKVSTESQLLKNQINIHRGVCLHNGIVHNDKDEWTVDDCTECTCQNSATVCRKISCPLI
PCANATVPDGECCPRCGTPSDYAEDGWSPWSEWTHCSTTCGRGIQQRGRSCDRINSKCEG
TSVQTRDCYLQECDKRFKQDGGWSHWSPWSSCSVTCGEGVMTQIRLCNSPTPQMGGTDCQ
GKGRQTKTCKKSACPINGGWGPWSPWDTCSVTCGGGIQTRKRLCNDPVPKYGGKECIGDA
AMPQICNKQECPIDGCLSSPCFPGTKCTSSPDGSFTCGKCPLGYAGDGVICKDIDECKEV
PDACHTHNGIHRCENTEPGYNCHPCPARFSGPQPYGRGVEQATANKQVCTPRNPCKDGSH
DCHKNSDCIYLGVYSESMFRCECKPGYAGNGRICGEDSDLDGWPNTDLQCVANATYHCKK
DNCPNLPNSGQEDHDKDGLGDECDNDDDNDGIPDVRDNCPKVYNPAQYDADRDDVGDQCD
NCVFEANTDQTDTDNNGEGDACAIDIDGDGILNENDNCPYVYNVDQRDTDRDGVGDHCDN
CPLEHNPDQVDSDSDRVGDKCDNNQDIDEDGHQNNMDNCPYIANANQADHDKDGKGDACD
HDDDNDGIPDDKDNCRLAFNPDQLDSDNDGRGDVCKDDFDQDSVLDIHDVCPENFAISET
DFRRFQMVPLDPKGTSQIDPNWVVRHQGKELVQTVNCDPGIAVGYDEFSAVDFGGTFFVN
TDRDDDYAGFVFGYQSSSRFYTVMWKQITQTYWSHTPTRAQGYSGLSIKVVNSTTGPGEH
LRNALWHTGDTPGQVRTLWHDPKNIGWKDFTAYRWHLTHRPKTGLIRVTMYEGKRIMADS
GNIYDKTYAGGRLGLYVFSQEMVYFSDLKYECRGK
Download sequence
Identical sequences H2MQR9
ENSORLP00000021092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]