SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000021242 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000021242
Domain Number 1 Region: 818-876
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000262
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Domain Number 2 Region: 586-654
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000484
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 
Domain Number 3 Region: 13-70
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000654
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 4 Region: 709-763
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000902
Family TSP-1 type 1 repeat 0.0057
Further Details:      
 
Domain Number 5 Region: 765-823
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000131
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 6 Region: 532-591
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000109
Family TSP-1 type 1 repeat 0.01
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000021242
Domain Number - Region: 655-706
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00288
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000021242   Gene: ENSORLG00000016979   Transcript: ENSORLT00000021243
Sequence length 920
Comment pep:known_by_projection chromosome:MEDAKA1:9:29175392:29203467:-1 gene:ENSORLG00000016979 transcript:ENSORLT00000021243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SNSLEEELEVTTYWWGEWAKWTACTRTCGGGVMSQERHCLKQRKKVAGGKDNMTCIGNAK
KYHLCNTKECPATGRSFREEQCWSFNSQIYSGRSYQWKPLYPADYVHISSNPCDLHCTTI
DGQRQLMVMARDGTSCKYSSYRGVCVDGTCEPIGCDGVLFSSNTLDKCGVCQGDGSSCSR
VTGNFRRAATTLGYLFITQIPEGSWDIQIIERKKSADVLAVTDQAGNFFFNGAYKLDSPQ
NFHAAGTVFKYRRPMDVYETGIEYIVAKGPIDQAINILVWYQNGRTPYITYEYTVLRDSL
PAVPPPPVYTGSETSAGEVSGTTKSTPLDNLRVREGSYFKIISFLTLGINRRPAPEVLRI
QRCQPSLGVCAKGSRVVNTSPSKNKSFQKHSAFGRAPFASVPASLVTDCESGRMEPGSEP
DSTNLIWRDLLDGRIDPEELLINISTNQLLTQEEGLFSSENSFQIMVETSNSPIPNSTMA
KTKELSKDTRNQIIEMHQAGKTESAMVLYTNNFFKNQTITPPRYKNLKLSPADMYRWKLS
SQEPCSMTCSVGVSRSFVTCVRYDGIEVHDMYCDALTRPEPVHDFCIGRECQPRWEASSW
SECSRTCGEGFQFRQVRCWKMLSPGLDSSVYSDLCTMADLERPVERRACKSPTCGPQWEV
AEWTECPANCGRRAQVTRDVRCSDETRPCDPMSKPANTKNCTGPPCERQWTVSEWGPCSG
SCGQGKTVRHVFCKAPEGRVVPESQCSRENKPLAIHPCGERDCAPHWLSQDWDRCNTTCG
RGVKRRVVLCVGITGGKFKIFDEEACGHKDKPEEENTCFERPCFKWYTTPWSECTKTCGV
GVRMRDVKCYQGWELVRGCDPLTKPVAKQTCTLQPCPTEPPDESCQDRPSTNCLLALKVN
LCSHWYYSKACCHSCRAVRA
Download sequence
Identical sequences H2MR63
8090.ENSORLP00000021242 ENSORLP00000021242 ENSORLP00000021242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]