SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000021277 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000021277
Domain Number 1 Region: 4-451
Classification Level Classification E-value
Superfamily Sema domain 3.27e-105
Family Sema domain 0.00011
Further Details:      
 
Domain Number 2 Region: 1578-1706,1882-2038
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.85e-42
Family p120GAP domain-like 0.009
Further Details:      
 
Domain Number 3 Region: 1136-1201
Classification Level Classification E-value
Superfamily E set domains 0.000000000000364
Family Other IPT/TIG domains 0.028
Further Details:      
 
Domain Number 4 Region: 1035-1138
Classification Level Classification E-value
Superfamily E set domains 0.0000000000196
Family Other IPT/TIG domains 0.0094
Further Details:      
 
Domain Number 5 Region: 454-503
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000209
Family Plexin repeat 0.0027
Further Details:      
 
Domain Number 6 Region: 1227-1274
Classification Level Classification E-value
Superfamily E set domains 0.00000546
Family E-set domains of sugar-utilizing enzymes 0.077
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000021277
Domain Number - Region: 996-1036
Classification Level Classification E-value
Superfamily Plexin repeat 0.00589
Family Plexin repeat 0.0055
Further Details:      
 
Domain Number - Region: 1729-1822
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0158
Family Ubiquitin-related 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000021277   Gene: ENSORLG00000017004   Transcript: ENSORLT00000021278
Sequence length 2101
Comment pep:known_by_projection chromosome:MEDAKA1:23:21448377:21500822:-1 gene:ENSORLG00000017004 transcript:ENSORLT00000021278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PNLTLINNVVSDPRTGRLYVGAVNSLYQLNSDLEVEFESKTGPQIDNRLCTPPVTTACEE
AKDTNNHNKLLLVHSAKDILVVCGSVFRGICSLRNLSNINHVIYFSDSNGEKSYVASTEE
GLSVVGVMSYYMVGKTQLPVFLVGKGYSSHDSTKLIATRILQDYKDWGIFDSIIEASAVQ
ANPFVMRYLHDFRFAFTDNNFVYFLFSRTLGMQDMKIFTVIARMCEDDHNYYSYTELQLN
CSATNKYNKAQAAFVGEPGQVLAKNLSSTAPASLKQPLASSFGQKQANSSALCMYPLQAI
NHRLEQLIGACYLKNGLINDKSVVYSPYASKEQEPCGVHPNVKSDNFKCGAEFLPSPLAS
KAEFALSTEPSVVHKGRMTAVAVAVEMGHAVAFLGTATGKVLKVHLSASSRGHEQELGEV
TGDEVNKNLLFDSSREHLFITTSNKISKVPVQACHLKTTCQDCVSMKDPYCGWCVLEGKC
SQKKDCGRSTERNTWLWSPDQKCVEIETFEPPNLSCRKTQQVYLIQPNIPEFGPKESFFV
NFIKHIVIIFFKNYSCLCTNVFPEAKVEPQLLKGAKKWISVTVESKKMFVTLAKPSLNHS
DVIQTCFLRSSMCPDVRRQFWPAGLCVKWPYEPPGHWKTHLHSPLGSSRSSLRSSIDPTT
HDPIPSVQVNPKYKYLEKDETIPSKQFALCCACPLVAKEAQVTVGWSQVKLCSFGILAKN
NIIIIKGSLGTLLNHASVSPPLHVWGPGGSVSAVFLLRWPARCPILRSSRQPLETGVGEP
ICSSYLHSFERLCVRPAQDPSEQNHGSDVWKVSLLQLRRHSQEQREHAVRPTTHTRSSKK
NVHSPDSDTCVFSHHQSMTVLRFSICHIQTEGCWFTASVFFSSALKPENCPQFESPKPLL
IPVGSAIPISFHGKNLDIYDVSCSDSLVKSQSSIRVKVSCKNLVSSFKIKAAKVQDFSYD
EQQEVNVSFHIKDNDNHKIDSTLTAVVLYNCAVGREDCSLCKHADAKYNCVWCAEQNRCV
YRNLCPALEPESSQCPDPKIVDIIPRFGPMNGRIAVTIKGSNMGVRKQDIKRITVAGVDC
IHLEDRYSVSTSVVCEIGPARSAPPSDIPVEQRTSGVVEVEVAGGKKGTSQVVFTYRDPK
PTTILPTKGPAAGGTVITIRGENLDTATKEDVAVSVGNVPCEVLSFGTEITCKTGKYLGQ
KVPTDPLLVTVKYGRNTTKDVREAFQYCENPKISSYKPKSSFMCGGRNITVKGIGFDLIQ
LAMMKVKVTVDEPSDAPAVEEISSSLCLVCQFVQRVQHKNDTTLEFFSPAVNCCSSSQSL
QTFIQLDNMEEELRSFDYHTNPTFNKLEKNMITDTRFVIVNVGQTLHFKSKDSSSLLPVD
GRGFLKAMTQEEAKAFIEDVPCRVNVMQDDTLMLEAPQSQPKSKNQLRNSTNDMLELKVK
FGWGTWMVGHVYYQGGKEDIPLAIIIPAVIVPMLLFIVMSVYCYRRKSQQAEREYEKVRH
QLESLEESVRDRCKKEFTDLMIEMEDHTSELSEGRIPFLDYKTYTDRNFFWPSKDSSNDP
MITGNIPVPEARKATVNQALTQFSNLLNSKTFLINFIRTLESRPDFNARARGYFASLLTV
ALHGKLEYYTDIMRTLLLELMDEHVQSKNPKLMLRRSETVVERMLCNWMSICLYQFLRDS
AGEPLYKLFRALKHQVEKGPVDAKMKKAKYTLNDTGLLGDDVEYSVLNLQVLVHGEGPDV
TPVKVLNCDTITQVKEKILDQVYRNQPYSQRPKLESVALEWRPGSTGQILSDLDLTSQKE
GRWKRINTLAHYNVRDNATVVLSTVMHTQSFHQHQDSHDEKNALLEDDDNTFHLVRPTEE
MDEVKSKRGSMKDKAMTKAITELYLTRLLSVKGTLQQFVDNFFSSVLGSGSALPPAIKYF
FDFLDEQGQRHDNVDEETLHIWKTNSLPLRFWVNILRNPHFILDVHVTEVVDASLHVIAQ
TFMDACTKTEHKLTRESPSNKLLYAKEISSYKRMVDDYYKNIRELIPVSDQDMNTHLAEV
SRQHTGKLNTQAALHQLYHYASKYYDVIIQSLDEDPAAQNKQLTLRLQQIAAALENKVTD
L
Download sequence
Identical sequences H2MR98
ENSORLP00000021277 8090.ENSORLP00000021277 ENSORLP00000021277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]