SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000021285 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000021285
Domain Number 1 Region: 30-90
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000126
Family VWC domain 0.00026
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000021285
Domain Number - Region: 1238-1287
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.0617
Family Fibrinogen C-terminal domain-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000021285   Gene: ENSORLG00000017013   Transcript: ENSORLT00000021286
Sequence length 1446
Comment pep:known chromosome:MEDAKA1:8:24023657:24041310:-1 gene:ENSORLG00000017013 transcript:ENSORLT00000021286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSFVDLRLLVLLSSAALLISAQGEDDRTTKTCIYEGQVFADRDVWKPMPCKICVCDAGS
ILCDEVVCEEVTCANPIIPHDECCPVCPDDGYNEGAVEGAKGPRGPKGERGPAGPPGRDG
QPGRPGLPGPPGPPGPPGLGGNFSPQMSGGYDDKSPAMPVPGPMGPMGSRGPPGPPGASG
PQGFTGPPGEPGEAGAPGPMGPRGPAGPPGKNGEDGESGKPGRAGERGPPGPQGARGFPG
TPGLPGIKGHRGFSGLDGAKGDTGPAGPKGEAGTPGENGTPGAMGPRGLPGERGRAGPSG
AAGARGNDGAAGAAGPPGPTGPAGPPGFPGGPGAKGEIGPQGARGPEGPAGARGEPGNPG
PAGPAGPSGNPGADGAAGAKGAPGAPGAAGAPGFPGPRGPPGPQGAGGAPGPKGNNGEVG
APGAKGEPGAKGEAGAPGAQGPPGAHGEEGKRGARGEPGAPGARGAPGERGAPGGRGFPG
SDGPAGAKGAPGERGAPGLVGPKGSTGEPGRTGEPGLPGAKGMTGSPGSPGPDGKTGPAG
APGQDGRPGPPGSVGARGQPGVMGFPGPKGAAGDAGKPGERGVMGPTGPAGAPGKDGDSG
PQGPSGPSGPAGERGEQGPAGAPGFQGLPGPQGAIGEPGKPGEQGLPGDAGAPGLTGARG
DRGFPGERGAPGPVGPAGARGSPGSAGNDGAKGDAGAPGAPGAQGPPGLQGMPGERGAAG
LPGLRGDRGDQGAKGADGAPGKDGARGLTGPIGLPGPAGAPGDKGEPGAAGPVGPAGARG
APGERGESGPPGPAGFAGPPGSDGQPGAKGESGENGAKGDAGPPGPAGPTGAPGPQGPVG
NTGAKGARGPAGPPGATGFPGGAGRVGPPGPAGNPGPPGPTGQAGKEGPKGNRGETGPAG
RPGEVGAAGPPGPSGEKGSPGADGAPGSAGLPGPQGIAGQRGIVGLPGQRGERGFPGLPG
PAGEVGKQGPVGPGGERGPPGPSGPPGLAGPPGEPGREGTPGNEGSAGRDGAPGPKGDRG
ESGPSGAPGAPGPPGAPGPVGPAGKSGDRGETGPAGPAGASGPAGPRGPAGPPGLRGDKG
ETGEAGERGMKGHRGFTGMQGPPGPSGPPGEQGPAGSAGPAGPRGPAGSAGVPGKDGMSG
LPGPTGPPGPRGRSGEMGPAGPPGPPGPAGAPGAPGGGFDLGFIAQPQEKAPDPFRMFRA
DDANVLRDRDLEVDSTLKSLSQQIEQIRSPDGTRKNPARTCRDLKMCHPDWKSGEYWIDP
DQGCTQDAIKVYCNMETGETCVSPTQREVAQKNWYISKNIKEKKHVWFGETMNDGFQFEY
GSEGSLPEDVNIQLTFLRLMSTEASQNLTYHCKNSVAYMDAAAGNLKKALLLQGSNEIEI
RAEGNSRFTYSVLEDGCTSHTGTWGKTVIDYKTSKTSRLPIIDIAPMDIGAPDQEFGLEV
GPVCFL
Download sequence
Identical sequences H2MRA6
ENSORLP00000021285 ENSORLP00000021285 8090.ENSORLP00000021285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]