SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000021960 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000021960
Domain Number 1 Region: 1010-1324
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.74e-54
Family Complement components 0.00013
Further Details:      
 
Domain Number 2 Region: 1546-1699
Classification Level Classification E-value
Superfamily TIMP-like 2.55e-25
Family Netrin-like domain (NTR/C345C module) 0.00049
Further Details:      
 
Domain Number 3 Region: 1404-1547
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 0.000000000000017
Family Alpha-macroglobulin receptor domain 0.0077
Further Details:      
 
Domain Number 4 Region: 697-754
Classification Level Classification E-value
Superfamily Anaphylotoxins (complement system) 0.000000000301
Family Anaphylotoxins (complement system) 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000021960   Gene: ENSORLG00000017552   Transcript: ENSORLT00000021961
Sequence length 1700
Comment pep:known_by_projection chromosome:MEDAKA1:9:31396677:31439731:-1 gene:ENSORLG00000017552 transcript:ENSORLT00000021961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGSIVHVCCKDKFEFFLSPAWGFGQMYLVTAPSSFRVDAVETVFVQLFGYTREVTVFVFL
KDSMAPNHKLLSRDVLTLNANNKFQALANVQLYPNVLTKDIQKVVLHVQSDEINNHVFVP
ISRSNGFMFIQTDKPLYTPHQNVKVRAFSMNQELRPANRSVFLTFKDPDRVTVDVVEMVD
INNGIPTMQKRFKIPIKPKLGIWTIEASYSDDFTTTAVTDFEVKEYESVLPSIDINVQPS
LNFISDTNFNSFDFKISARYVHGAPVADGEVFLRYGYELERLQKDVDPDVLRTAEMANQG
LILGICEIVSKSYEVLSKHDGPRELSSLVGKYLYMAVLVQEETGGISQEAEFASVKFLKS
PYHLSLISTPPFIKPGLPYNIKLLVKDHLDKPVNRVSVELVEQRQITETGETNVLNCGNN
NQLRSDSDGFIYLICNPWKTSVKAVLKFQTAGLAEANRATLTLESVAYHSPNERYLYINT
PMFGKSLVVGRDTQIQVQTASPSYLNIQALNYLVLSKGKVVFHKSVDFVRSLDGTNSLNF
MVTPSMVPSIRLLVFYILHGEGTSELVADSVWIDVKHKCINGLETSVTVDTRIHKPKENL
NIDIRANQPGLVALSAVDSAVYSIRRNYKDPISMVLRHIEQSDLGCGGGGGKDNADVFRL
AGLTFLTNANAQSTSVEDEPCTAAVRSKRALSDEAKEAKAQSYGSLKPCCVKGMQYIPRS
VTCRQYALQYKKLTHRCREAFRECCEFYQKNKDDGDLILARRESTMNIGVNFDEVPQVRS
YFPESWLWEVQPISSGKLSVSGKLPDSLTTWEIQAVGMFPSGGMCVADTAKVSVNLPLSV
DIPLPYQVVRGEQVVLQGSVYNQQDKSIKYCVTLMAGPAVCLLQSQPVSGQPGLHSTGCK
WNYLSANGVGKVVFTLLGLEPGMHTLTFTLKTTDGIRDILEKNLRVVPEGVRRDVDSGGS
LDPQGVYGSKKLKVVLHNQMPANVVPNSAVQRMLAINGELPGEVVTVLTKPEGIKTLIDL
PLGLAIAKLDTLFLLTQVYLYLETTSSWDLFGANSQKSSADLKQKIQDGLIDLSSIRNGD
SSYSTSIKAEPSTWVTAMVVKVLALADSVMSLDHQSLSESVTWLISKTQQADGSFSELSS
FKPNRAMVEGADPIEKSVYVTSIVLIALQRASEIRDERLQLRINTAAYHRHNRYLSQHAR
DVKSVYVRAVATYALTLHDPNSIAVSELISSLESVARQKGNPVELRYWQEADVTADWIKP
DQSSGQTVETTSYVLLTMLLKGRIPYANPILSWLTQDQYYGDGFFSSTDMVLTLEALTEY
KKLIPRTELDQQINIRYNRKGEVKRVALNRRQPVVAPIEISLTDDITVSTGYGKGVSNVK
LKTVFYQTTASLQTRCNFELNIEMSGSNPSETSGSSTEAPHLAACVKYKPPLNEVSTASS
LTVLKIQLPTGVEPYLEDLRQFMDPDNPIISHYELQGSTVVILMDTVPSDIFLCVGFRVR
TRFKVVGASDCLFTVSERQDRGSLCTKEFSPQHQMLQRLCLGEQCQCMTAACAAYRGNVD
LSLTSVQRREELCQPHVKYGLIVAVRSSASEGDFMIYSASVVEVLKNTEKDLEALNPKSE
VELVKKATCTSINLQDNKQYLVFGSRGSEVQNGRHFKYRLALDSEALVELLSTDCSSDLC
QKHQAQMEDFSVYFMLNECI
Download sequence
Identical sequences H2MT65
ENSORLP00000021960 ENSORLP00000021960 8090.ENSORLP00000021960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]