SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000022200 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000022200
Domain Number 1 Region: 90-148
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000105
Family VWC domain 0.017
Further Details:      
 
Domain Number 2 Region: 26-87
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000387
Family VWC domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000022200   Gene: ENSORLG00000017737   Transcript: ENSORLT00000022201
Sequence length 221
Comment pep:known_by_projection chromosome:MEDAKA1:17:30089753:30091528:-1 gene:ENSORLG00000017737 transcript:ENSORLT00000022201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARTFLTLALCAQVGSGFSVSEQQENTCEANGSTYYLGEWYFLDSDHCTQCECTAEGSVC
ARTECTSLPAACIHVSHYPSDCCPRCEKIGCEYRGVVYELGQNFQPSECEQCTCDSDGIA
RCLVADCAPPPCVDPVYQPGKCCPECKEGPNCYVDASHSQVIPAGDPVWVDSCTKCRCHD
GQDAGYWEGNRLASCSRLKGCTPQQPSYQPNGFSAAQKAEA
Download sequence
Identical sequences H2MTU1
ENSORLP00000022200 ENSORLP00000022200 8090.ENSORLP00000022200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]