SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000022311 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000022311
Domain Number 1 Region: 955-1168
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.34e-106
Family Thrombospondin C-terminal domain 0.00000000317
Further Details:      
 
Domain Number 2 Region: 30-233
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-40
Family Laminin G-like module 0.000000499
Further Details:      
 
Domain Number 3 Region: 844-953
Classification Level Classification E-value
Superfamily TSP type-3 repeat 3.92e-32
Family TSP type-3 repeat 0.000000863
Further Details:      
 
Domain Number 4 Region: 488-546
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 1.27e-16
Family TSP-1 type 1 repeat 0.0000457
Further Details:      
 
Domain Number 5 Region: 434-489
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000196
Family TSP-1 type 1 repeat 0.0000703
Further Details:      
 
Domain Number 6 Region: 691-784
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000000157
Family TSP type-3 repeat 0.00012
Further Details:      
 
Domain Number 7 Region: 315-372
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000115
Family VWC domain 0.0045
Further Details:      
 
Domain Number 8 Region: 379-428
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000288
Family TSP-1 type 1 repeat 0.00084
Further Details:      
 
Domain Number 9 Region: 547-600
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000046
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000022311   Gene: ENSORLG00000017831   Transcript: ENSORLT00000022312
Sequence length 1170
Comment pep:known_by_projection chromosome:MEDAKA1:24:20495991:20505177:-1 gene:ENSORLG00000017831 transcript:ENSORLT00000022312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTMTRASTVLLLMLCSCEAARVAESRDDNSVYDLFELIRVPNKNHGVTLVKGDDPYSPAY
KIVNPDLIPPLPDGAFRDLIDSIHAERGFLLLLNFKQFKRTRGSILTVEKRDGSGPVLEI
VSNGKANTLDIVYSTENKQQVVSIEEVDLATGHWKNITLFVQEERAQLYVGCEEVNTAEL
DAPIHSILTQETPPGARLRVGKGAVKDRFMGVLQNVRFVFGTTLEAILRNKGCQSSTSDT
MILKNLNGSSAIRTEYTGHKTKDLQMVCGFSCEDLISMFKELKGLGVVVKELSNELRQLT
DENKLIKTRIGIHRGVCIHNGIVRKNRDEWTVDDCTECTCQNSATVCRKISCPLIPCANA
TVPDGECCPRCGTPSDYAEDGWSPWSEWTHCSVSCGRGIQQRGRSCDRINNNCEGTSVQT
RDCYLQECDKRFKQDGSWSHWSPWSSCSVTCGEGVITRIRLCNSPTPQLGGKQCEGEARQ
TQKCQKSPCPINGNWGPWSPWDLCTLTCGGGVQTRKRLCNNPAPLYGGKECVGEATDRQM
CNKKACPVDGCLSNPCFSGAKCTSFPDGSWKCGKCPNGYSGNGINCKDIDECKEVPDACF
EFNGVHRCENTDPGYNCLPCPPRYTGPQPYGQGIEEAAANKQVCTPRNPCLDGSHDCNKN
ARCNYLGHFSDPMFRCECKPGFAGNGHICGEDTDLDGWPNADLVCVENATYHCKKDNCPN
LPNSGQEDYDKDGIGDACDDDDDNDGIPDDRDNCPFVYNPRQYDYDRDEVGDRCDNCPYN
SNPDQADTDNNGEGDACAVTLAVNSPLHYLQLTFRNKLASVKEESCKSVATGLQLLVTDL
SQLQVDSDDDRVGDKCDSNQDIDEDGHQNNLDNCPYISNANQVDHDKDGKGDACDHDDDN
DGIPDDKDNCRLAFNPDQLDSDGDGRGDACKEDFDLDNVPDIYDVCPENFDISETDFRKF
QMVPLDPKGTSQIDPNWVVRHQGKELVQTVNCDPGIAVGYHEFNSVDFSGTFFINTERDD
DYAGFVFGYQSSSRFYVVMWKQITQTYWSHKPTKAQGYSGLSIKVVNSTTGPGEHLRNAL
WHTGNTPGQVRTLWHDPKNVGWKDFTAYRWHLIHRPRTGLIRVVMYEGKKMMADSGSIYD
KTYAGGRLGLFVFSQEMVYFSDLKYECRGM
Download sequence
Identical sequences H2MU52
ENSORLP00000022311 8090.ENSORLP00000022311 ENSORLP00000022311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]