SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000022338 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000022338
Domain Number 1 Region: 736-1314
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 9.42e-198
Family Myeloperoxidase-like 0.000000000523
Further Details:      
 
Domain Number 2 Region: 67-245
Classification Level Classification E-value
Superfamily L domain-like 5.65e-38
Family Ngr ectodomain-like 0.0079
Further Details:      
 
Domain Number 3 Region: 341-435
Classification Level Classification E-value
Superfamily Immunoglobulin 1.4e-26
Family I set domains 0.016
Further Details:      
 
Domain Number 4 Region: 425-519
Classification Level Classification E-value
Superfamily Immunoglobulin 2.51e-24
Family I set domains 0.012
Further Details:      
 
Domain Number 5 Region: 245-340
Classification Level Classification E-value
Superfamily Immunoglobulin 3.52e-23
Family I set domains 0.015
Further Details:      
 
Domain Number 6 Region: 525-614
Classification Level Classification E-value
Superfamily Immunoglobulin 7.53e-23
Family V set domains (antibody variable domain-like) 0.091
Further Details:      
 
Domain Number 7 Region: 1411-1469
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000868
Family VWC domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000022338   Gene: ENSORLG00000017847   Transcript: ENSORLT00000022339
Sequence length 1483
Comment pep:known_by_projection chromosome:MEDAKA1:22:20025086:20067747:-1 gene:ENSORLG00000017847 transcript:ENSORLT00000022339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCVNVLNLCVCTHLVCMCTHPVCVFVSTHLVRVCTHPVCVFVSTHLVCTHLMCVFVSHLV
LFCPHRDLRFNKIKDLQPASFSRLKNLNTLLLNNNQIRRISRGAFEDLENLKYLYLYKNE
IQSIDRQAFKGLVSLEQLYLHFNNIESLEPESFSHLPKLERLFLHNNRITQLVPGTFSHL
SAMKRLRLDSNALNCNCEVLWLADLLKLYAESGNAQAAATCDHPSRLQGRSVATLTAEEL
NCELPRITSEPQDVDVTLGNTVYFTCRAEGNPKPQIIWLRNNNALNMRDDSRLNLLEDGT
LMIQDTRETDQGVYQCMAKNVAGEVKTSQVTLRYFGAPTRPSFVIQPQNTEVLVGESVTL
ECSATGQPQPRVSWTKGDRTPLPNDPRITITTSGGLYIQNVQQADGGQYTCFASNNVDTI
HATAFIIVQATPQFTVTPQDQTVLESHTVEFPCEASGYPPPVIAWTRGGSALPLDRRHVV
LSSGMLRITRVAAHDEGQYECQAVSPVGTVHASVQLRVEQRVITPVFTNAPRDLTVESGQ
DVQIPCRAQGQPPPVLTWIKDGVQVTESGKFHISPEGFLEVRDAGTADAGRYECTARNPI
GYQVAGMVLTVTVPAVSREGDTFVSTSIEQAIRDVDSAIESTRRRLFDGQPRTPGELLAL
FRYPRDPYTVEQARAGEIFEQTLLLIQNHVNRGLMVDTNGTAFRYNDLVSPRFLDMIANL
SGCTAHRRINNCSDICFHQKYRSHDGTCNNLQHPMWGASLTAFERLLKSVYDNGFNLPRG
ATDRLQNGYRLPLPRLVSTTMIGTETITPDDRYTHMLMQWGQFLDHDLDSTVVALSQSRF
SDGQLCAQVCTNDPPCFPIQFPPNDQRQLRTGARCMFFVRSSPVCGSGMTSLLMNSVYPR
EQINQITSYIDASNVYGSSRHESEEIRDLASQRGLLRQGIIQRTGKPLLPFSPGPPTECM
RDENESPIPCFLAGDHRANEQLALTAMHTVWFREHNRIATELLRLNPHWDGDTIYHEARK
IVGAQMQHITYSHWLPKILGEVGMKMLGPYKSYDPNVNAGIFNAFATAAFRFGHTLINPI
LYRLNEHFQPIPQGHISLHKAFFSPFRIVNEGGIDPLLRGLFGVPGKMRVSTQLLNTELT
ERLFSMAHAVALDLAAMNVQRGRDHGIPPYNDYRTFCNLSSAQTFDDLKNEIKNPIIREK
LQRLYGTPQNIDLFPALMAEDIIPGSRLGPTLMCLLTTQFKLVRNGDRFWYENPGVFTPS
QLTQLKQASLARVLCDNGDNITRVQSDVFMVAELPHGFGSCDDIPHIDLRMWQDCCEDCR
TKGQFNALSYHFRGRRSAEHSYREESPAHRIQEKRLVEEAGKSLQNVSVTSIKTTEPSVG
DFQDFVTDMQKTISSLRKQIKRLESRLSRTDCTDRDGRERKDGERWKDDSCSTCQCRDAQ
VTCFVESCPPVACRKPIKAKGACCPVCPQEATPDEAKAKVQLQ
Download sequence
Identical sequences H2MU79
ENSORLP00000022338 8090.ENSORLP00000022338 ENSORLP00000022338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]