SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000022339 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000022339
Domain Number 1 Region: 1-283
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 2e-99
Family Myeloperoxidase-like 0.000000249
Further Details:      
 
Domain Number 2 Region: 380-438
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000167
Family VWC domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000022339   Gene: ENSORLG00000017847   Transcript: ENSORLT00000022340
Sequence length 452
Comment pep:known_by_projection chromosome:MEDAKA1:22:20025086:20032076:-1 gene:ENSORLG00000017847 transcript:ENSORLT00000022340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHTVWFREHNRIATELLRLNPHWDGDTIYHEARKIVGAQMQHITYSHWLPKILGEVGMKM
LGPYKSYDPNVNAGIFNAFATAAFRFGHTLINPILYRLNEHFQPIPQGHISLHKAFFSPF
RIVNEGGIDPLLRGLFGVPGKMRVSTQLLNTELTERLFSMAHAVALDLAAMNVQRGRDHG
IPPYNDYRTFCNLSSAQTFDDLKNEIKNPIIREKLQRFWYENPGVFTPSQLTQLKQASLA
RVLCDNGDNITRVQSDVFMVAELPHGFGSCDDIPHIDLRMWQDCCEDCRTKGQFNALSYH
FRGRRSAEHSYREESPAHRIQEKRLVEEAGKSLQNVSVTSIKTTEPSVGDFQDFVTDMQK
TISSLRKQIKRLESRLSRTDCTDRDGRERKDGERWKDDSCSTCQCRDAQVTCFVESCPPV
ACRKPIKAKGACCPVCPQEATPDEAKAKVQLQ
Download sequence
Identical sequences H2MU80
ENSORLP00000022339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]