SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000022456 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000022456
Domain Number 1 Region: 34-98
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000291
Family Ovomucoid domain III-like 0.0066
Further Details:      
 
Domain Number 2 Region: 145-222
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000106
Family Calmodulin-like 0.078
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000022456
Domain Number - Region: 228-268
Classification Level Classification E-value
Superfamily FnI-like domain 0.000241
Family VWC domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000022456   Gene: ENSORLG00000017943   Transcript: ENSORLT00000022457
Sequence length 315
Comment pep:known_by_projection chromosome:MEDAKA1:21:27527118:27539745:1 gene:ENSORLG00000017943 transcript:ENSORLT00000022457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VILRTFISMVFLSLLLVCLIQEQQQSKSKVCANVFCGAGRECAVTEKGEPSCLCIESCKP
HKRSVCGSNGKTYRNHCELHRDACLTGLKIQVAHDGHCKEKKAEKAAANPVVCYAADRNE
LRHRLIQWLQTEIVPDGWFVKGSNFSEILLKYFKIYDNGDSQLDSSELLKFIQHNDSVVK
LQSYADQESNKLLRSLCVDALIELSDENADWKLSFDEFLNCLKPDFNPPEKKCALEDETF
EDGAETQVECNRCVCACGNWVCTAMICTGDHKHVAAGESADVGAEMTEEEWNLRVAELNK
HQDTMEKMKTSTKEI
Download sequence
Identical sequences H2MUJ1
ENSORLP00000022456 8090.ENSORLP00000022456 ENSORLP00000022456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]