SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000022506 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000022506
Domain Number 1 Region: 48-284
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.01e-48
Family DBL homology domain (DH-domain) 0.0000555
Further Details:      
 
Domain Number 2 Region: 285-410
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-29
Family Pleckstrin-homology domain (PH domain) 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000022506   Gene: ENSORLG00000017973   Transcript: ENSORLT00000022507
Sequence length 908
Comment pep:known_by_projection chromosome:MEDAKA1:17:31456790:31464222:-1 gene:ENSORLG00000017973 transcript:ENSORLT00000022507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNPDSRFRPPPEDAQSLGFAESINFEEHHYAMLQKGLESDAQNLEAESWSLTVDQNVLE
RLSKEAVKRQDVIYELIQTEMNLVRTLKIIFHVYMHELRQALQMDDPHLERLFPAVESLL
GLHQLFLLSLKELQSRSLQEGQAVISVAQLASILISQFSDLAGEHVIHSYSHFCSHQSEA
LSFFKEQMQVNRKLHILVKRIDQLPLVRRLGLPECFLLVAQRITKYPVLVERILQNTGAD
TEEHRSLQKGLGLIKDAISQVDTNVCEYMKTARLRDIGHRLEGRPQSRPKEPCPFRREDL
IQGSCSLLHEGTLTWKWSGKQKEVLAVLLSDMLLLLQEKEQKLVFASMENRVQVIPLQRL
IVREVAMEEKAMYLIYVSASAMPEMYELHSSSKDECLRWMALIRQAVDSCTGSASDRLVF
SQQEEELYKEQIRPLQQFQDQLQKWDRQIVECLTGKLKDSAALYENLAAQKPPHTSLLLH
GDTKEALQGGGLLNGAIEEVENLQNMLFMQLMDPNVPAEGGLPRSSKQPRELRGKGEEEP
GRSSKTSSDGGLLSSGRNRHLQLRVPSGTLRYHFCVDSRLRQRWTLPQSTGAPPAPVSTP
GQTLKVRPARKLGSRRIRRHPRNEPFVLQAVIAKQDSRIELQQAIQLKIKQPRHHGNLLL
EKERQRTLEKQKEDLASLHKLQAQHREEQQRWEKERERQMKRVEVLEAQLQQREEECKRR
EETLSEEKSQLERQKEAYQQDLERLREATRSVEKEHRRLGQEREPMKKSGAASDLLSLQP
SGLSSHPSLGVNGGGPKATLRPDDTPPKVPQRNESMRSRPSKQHNPPYASKTTSQVQNPP
GVQQKIPTKLATKGKEKSFKGKRTHQRAQSAASIDVTEVLPIRTTGKEGGSLRAQRSNSP
RRNLNPGR
Download sequence
Identical sequences H2MUP0
ENSORLP00000022506 8090.ENSORLP00000022506 ENSORLP00000022506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]