SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000022560 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000022560
Domain Number 1 Region: 5-72
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000565
Family Growth factor receptor domain 0.0037
Further Details:      
 
Domain Number 2 Region: 171-216
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000667
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 3 Region: 68-109
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000921
Family VWC domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000022560   Gene: ENSORLG00000018013   Transcript: ENSORLT00000022561
Sequence length 315
Comment pep:known_by_projection chromosome:MEDAKA1:24:22686197:22690663:-1 gene:ENSORLG00000018013 transcript:ENSORLT00000022561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFCRWPCSCPEWSACAPGVSSVLDGCGCCKSCARQFGEPCNERDVCDPHRGLYCDFSADK
PRYQVGKCAYMMGVGCDLNGIHYNNGEVFQPSPLYNCTCIAGAIGCMPVFIQKPAGILGA
SPLTGRKHLQDTTYMSGVLTKCCDHIIITSGLVLTSLTLEVYRDPPLTWKRNCLIQTTPW
SPCSKTCGMGISVRITNDNGKCEMRKDSRLCLLRPCDKGLLKSVKMPKGKTCQPKFQAKV
AEKLSLSGCTSTKKFRPTYCGICTDQRCCVPNKSSMIRVDFSCRGGSDTQWKMQWITSCV
CQRKCSNPGDMFSDL
Download sequence
Identical sequences H2MUU1
ENSORLP00000022560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]