SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000022627 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000022627
Domain Number 1 Region: 45-116
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000121
Family Growth factor receptor domain 0.0063
Further Details:      
 
Domain Number 2 Region: 108-180
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000115
Family Fibronectin type I module 0.023
Further Details:      
 
Domain Number 3 Region: 209-255
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000085
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000022627   Gene: ENSORLG00000018064   Transcript: ENSORLT00000022628
Sequence length 359
Comment pep:known_by_projection chromosome:MEDAKA1:24:22909870:22912954:1 gene:ENSORLG00000018064 transcript:ENSORLT00000022628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLGLLPLTKEVTSGLSAPSQTKPLHTGPQQGKAVERYAAGQECSGQCSCPSAPPRCPPGV
SLVLDGCGCCRVCAKQMGELCTDKDVCDPHKNLFCDIGAPISRRIGVCTAREGASCVFGG
TVYKSGETFQSSCKYQCTCMDGAMGCVPLCSMDIRLPSPDCPMPRRVKVPGKCCEEWECD
SPYKDTLLGPALSAFREEETYGPDPNMMRENCLVQTTEWSACSKTCGLGISTRVTNDNHE
CRLEKQTRLCMVRPCESQMEQSIKKGKKCIRTPRVSKPMKFEISGCTTTKSYRPKFCGVC
LDGRCCTPHRTTTLPMEFKCPDGQVMKKHMMFIKSCACHYNCPGENDIFEAMYYKKMTG
Download sequence
Identical sequences H2MV04
ENSORLP00000022627 ENSORLP00000022627 8090.ENSORLP00000022627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]